Recombinant Human Nucleoplasmin-3 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Nucleoplasmin-3 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 31-140 of Human NPM3 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:PVTMDSFFFGCELSGHTRSFTFKVEEEDDAEHVLALTMLCLTEGAKDECNVVEVVARNHDHQEIAVPVANLKLSCQPMLSLDDFQLQPPVTFRLKSGSGPVRITGRHQIV

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
NPM3

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Nucleoplasmin-3 Protein

  • nucleophosmin/nucleoplasmin 3
  • nucleophosmin/nucleoplasmin family, member 3
  • nucleoplasmin-3
  • PORMIN
  • TMEM123

Background

The protein encoded by this gene is related to the nuclear chaperone phosphoproteins, nucleoplasmin and nucleophosmin. It is highly homologous to the murine Npm3 gene. Based on the structural similarity of the human NPM3 gene product to nucleoplasmin and nucleophosmin, NPM3 may represent a new member of this gene family, and may share basic functions with the molecular chaperones. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-61646
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
423-F8/CF
Species: Hu, Mu
NBP2-13673
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-07996
Species: Hu
NBP2-52486
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, ICC, IF
AF-242-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP1-91823
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-33736
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBL1-11569
Species: Hu
NBP1-81244
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-44179
Species: Mu
Applications: WB, ELISA
NBP2-33910
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-07755
Species: Hu
NBP1-90058
Species: Hu
Applications: WB, IHC, IHC-P
NB100-616
Species: Hu, Mu, Rt, Md, Pm
Applications: WB, ChIP, EM, ICC/IF, IP, In vitro, Flow-IC
NBP1-84254
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-85351
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB21-2024
Species: Hu, Mu, Rt, Ma
Applications: WB, ChIP, DB, ICC/IF

Publications for Nucleoplasmin-3 Partial Recombinant Protein (H00010360-Q01) (0)

There are no publications for Nucleoplasmin-3 Partial Recombinant Protein (H00010360-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Nucleoplasmin-3 Partial Recombinant Protein (H00010360-Q01) (0)

There are no reviews for Nucleoplasmin-3 Partial Recombinant Protein (H00010360-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Nucleoplasmin-3 Partial Recombinant Protein (H00010360-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Nucleoplasmin-3 Products

Bioinformatics Tool for Nucleoplasmin-3 Partial Recombinant Protein (H00010360-Q01)

Discover related pathways, diseases and genes to Nucleoplasmin-3 Partial Recombinant Protein (H00010360-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Nucleoplasmin-3 Partial Recombinant Protein (H00010360-Q01)

Discover more about diseases related to Nucleoplasmin-3 Partial Recombinant Protein (H00010360-Q01).
 

Pathways for Nucleoplasmin-3 Partial Recombinant Protein (H00010360-Q01)

View related products by pathway.

PTMs for Nucleoplasmin-3 Partial Recombinant Protein (H00010360-Q01)

Learn more about PTMs related to Nucleoplasmin-3 Partial Recombinant Protein (H00010360-Q01).

Blogs on Nucleoplasmin-3

There are no specific blogs for Nucleoplasmin-3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

FGF-8 [Unconjugated]
423-F8-025/CF

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Nucleoplasmin-3 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol NPM3