NSRP1 Antibody

Images

 
Western Blot: NSRP1 Antibody [NBP1-90548] - Analysis in HEK293 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-NSRP1 antibody. Remaining relative intensity is presented. Loading ...read more
Immunocytochemistry/ Immunofluorescence: NSRP1 Antibody [NBP1-90548] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: NSRP1 Antibody [NBP1-90548] - Staining of human gall bladder shows strong nuclear positivity in glandular cells.
Western Blot: NSRP1 Antibody [NBP1-90548] - Analysis in human cell line HEK 293.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
     

Genetic Strategies

   

Order Details

NSRP1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:KREVGVQSSERNQDRKESSPNSRAKDKFLDQERSNKMRNMAKDKERNQEKPSNSESSLGAKHRLTEEGQEKGKEQERPPEAVSKFAKRNNEETVM
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NSRP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:500-1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
NSRP1 Protein (NBP1-90548PEP)
Publications
Read Publication using NBP1-90548.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NSRP1 Antibody

  • CCDC55
  • coiled-coil domain containing 55
  • coiled-coil domain-containing protein 55
  • DKFZp434K1421
  • FLJ37233
  • HSPC095
  • NSrp70
  • nuclear speckle splicing regulatory protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-20324
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87349
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF5540
Species: Mu
Applications: WB
NBP2-47476
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF4928
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP1-86191
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1774
Species: Hu, Rt, Am, Dr
Applications: WB, EM, ELISA, ICC/IF, IP
NBP1-57578
Species: Hu
Applications: WB
NBP1-47386
Species: Hu, Mu, Rb(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-88036
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for NSRP1 Antibody (NBP1-90548)(1)

Reviews for NSRP1 Antibody (NBP1-90548) (0)

There are no reviews for NSRP1 Antibody (NBP1-90548). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for NSRP1 Antibody (NBP1-90548) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NSRP1 Products

Bioinformatics Tool for NSRP1 Antibody (NBP1-90548)

Discover related pathways, diseases and genes to NSRP1 Antibody (NBP1-90548). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on NSRP1

There are no specific blogs for NSRP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NSRP1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NSRP1