NSRP1 Antibody - BSA Free

Immunohistochemistry-Paraffin: NSRP1 Antibody [NBP1-90548] - Staining of human colon, kidney, lymph node and testis using Anti-NSRP1 antibody NBP1-90548 (A) shows similar protein distribution across tissues to independent antibody NBP1-90547 (B).

Western Blot: NSRP1 Antibody [NBP1-90548] - Analysis in HEK293 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-NSRP1 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.

Immunocytochemistry/Immunofluorescence: NSRP1 Antibody [NBP1-90548] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm.

Immunohistochemistry-Paraffin: NSRP1 Antibody [NBP1-90548] - Staining of human colon.

Immunohistochemistry-Paraffin: NSRP1 Antibody [NBP1-90548] - Staining of human lymph node.

Immunohistochemistry-Paraffin: NSRP1 Antibody [NBP1-90548] - Staining of human kidney.

Immunohistochemistry-Paraffin: NSRP1 Antibody [NBP1-90548] - Staining of human testis.

Staining of human cell line U-251 MG shows localization to nucleoplasm.

Analysis in HEK293 cells transfected with control siRNA, target specific siRNA probe #1 and #2. Remaining relative intensity is presented. Loading control: Anti-GAPDH.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC, KD
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

NSRP1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: KREVGVQSSERNQDRKESSPNSRAKDKFLDQERSNKMRNMAKDKERNQEKPSNSESSLGAKHRLTEEGQEKGKEQERPPEAVSKFAKRNNEETVM
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NSRP1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Knockdown Validated
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  NSRP1 Protein (NBP1-90548PEP)

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for NSRP1 Antibody - BSA Free

• CCDC55
• coiled-coil domain containing 55
• coiled-coil domain-containing protein 55
• DKFZp434K1421
• FLJ37233
• HSPC095
• NSrp70
• nuclear speckle splicing regulatory protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for NSRP1 Antibody (NBP1-90548)(1)

Publication using NBP1-90548

• Stadler C, Rexhepaj E, Singan VR et al. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nat Methods 2013-04-01 [PMID: 23435261]

Bioinformatics

• Gene Symbol: NSRP1