NPHP4 Antibody

Images

 
Immunohistochemistry: NPHP4 Antibody [NBP2-39059] - Staining of human fallopian tube shows strong membranous positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NPHP4 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: SQALVLRSRLRLPEMVGHPAFAVIFQLEYVFSSPAGVDGNAASVTSLSNLACMHMVRWAVWNPLLEADSGRVTLPLQGGIQPNPSHCLVYKVPSASMSSEEVKQVESGTLRFQ
Specificity
Specificity of human NPHP4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NPHP4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (80%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NPHP4 Antibody

  • FLJ46306
  • KIAA0673nephrocystin-4
  • nephrocystin 4
  • nephronophthisis 4
  • Nephroretinin
  • POC10 centriolar protein homolog
  • POC10
  • SLSN4nephroretinin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-59110
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq, GP, Rb, Ze
Applications: WB
NBP2-78258
Species: Hu
NBP1-84403
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-13249
Species: Hu
Applications: IHC, IHC-P
NBP1-83543
Species: Hu
Applications: IHC, IHC-P
NBP1-84412
Species: Hu
Applications: IHC, IHC-P
NBP2-14126
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-86991
Species: Hu, Mu
Applications: WB, ICC/IF, IP
NBP1-88691
Species: Hu
Applications: WB, IHC, IHC-P
MAB5175
Species: Mu
Applications: WB, IHC
NBP1-92123
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15309
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82539
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-59679
Species: Hu, Mu, Rt, Bv, Eq, GP, Rb
Applications: WB, IHC
NBP2-67627
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00003000-M06
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-38487
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00001069-M01
Species: Hu
Applications: WB, ELISA
NB100-77417
Species: Hu, Mu
Applications: WB, Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, In vivo, CyTOF-ready
NBP2-39059
Species: Hu
Applications: IHC, IHC-P

Publications for NPHP4 Antibody (NBP2-39059) (0)

There are no publications for NPHP4 Antibody (NBP2-39059).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NPHP4 Antibody (NBP2-39059) (0)

There are no reviews for NPHP4 Antibody (NBP2-39059). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for NPHP4 Antibody (NBP2-39059) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional NPHP4 Products

Array NBP2-39059

Bioinformatics Tool for NPHP4 Antibody (NBP2-39059)

Discover related pathways, diseases and genes to NPHP4 Antibody (NBP2-39059). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NPHP4 Antibody (NBP2-39059)

Discover more about diseases related to NPHP4 Antibody (NBP2-39059).
 

Pathways for NPHP4 Antibody (NBP2-39059)

View related products by pathway.

PTMs for NPHP4 Antibody (NBP2-39059)

Learn more about PTMs related to NPHP4 Antibody (NBP2-39059).

Blogs on NPHP4

There are no specific blogs for NPHP4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NPHP4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NPHP4
Uniprot