NPHP4 Antibody Summary
| Immunogen |
This antibody was developed against a recombinant protein corresponding to amino acids: SQALVLRSRLRLPEMVGHPAFAVIFQLEYVFSSPAGVDGNAASVTSLSNLACMHMVRWAVWNPLLEADSGRVTLPLQGGIQPNPSHCLVYKVPSASMSSEEVKQVESGTLRFQ |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
NPHP4 |
| Purity |
Immunogen affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:50 - 1:200
- Immunohistochemistry-Paraffin 1:50 - 1:200
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
Reactivity Notes
Immunogen displays the following percentage of sequence identity for non-tested species: Rat (80%)
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Immunogen affinity purified |
Alternate Names for NPHP4 Antibody
Background
NPHP4 encodes a protein which contains a proline-rich region. The encoded protein may function in renal tubular development and function. This protein interacts with nephrocystin. Mutations in this gene are associated with nephronophthisis type 4. Multiple alternative transcript variants have been described but their full-length nature has not been determined. [provided by RefSeq]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, WB
Species: Hu
Applications: ELISA, IHC, IP, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IP, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: ICC/IF, IP, WB
Species: Hu, Rt
Applications: IHC, IHC-P, WB
Species: Mu
Applications: IHC, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Hu, Rt
Applications: Flow, IHC, IHC-P, WB
Species: Hu
Applications: Simple Western, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Mu
Applications: CyTOF-ready, Flow, ICC, IHC, WB
Species: Hu
Applications: IHC
Publications for NPHP4 Antibody (NBP2-39059) (0)
There are no publications for NPHP4 Antibody (NBP2-39059).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for NPHP4 Antibody (NBP2-39059) (0)
There are no reviews for NPHP4 Antibody (NBP2-39059).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for NPHP4 Antibody (NBP2-39059) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional NPHP4 Products
Research Areas for NPHP4 Antibody (NBP2-39059)
Find related products by research area.
|
Blogs on NPHP4