NIPSNAP1 Antibody (3B7)

Images

 
Western Blot: NIPSNAP1 Antibody (3B7) [H00008508-M15] - Analysis of NIPSNAP1 expression in transfected 293T cell line by NIPSNAP1 monoclonal antibody (M15), clone 3B7. Lane 1: NIPSNAP1 transfected lysate (Predicted MW: ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
3B7
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

NIPSNAP1 Antibody (3B7) Summary

Immunogen
NIPSNAP1 (NP_003625.1, 185 a.a. ~ 284 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. YELRTYKLKPGTMIEWGNNWARAIKYRQENQEAVGGFFSQIGELYVVHHLWAYKDLQSREETRNAAWRKRGWDENVYYTVPLVRHMESRIMIPLKISPLQ
Specificity
NIPSNAP1 - nipsnap homolog 1 (C. elegans) (3B7)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
NIPSNAP1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Western Blot
Application Notes
It has been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for NIPSNAP1 Antibody (3B7)

  • nipsnap homolog 1 (C. elegans)
  • NIPSNAP, C. elegans, homolog 1,4-nitrophenylphosphatase domain and non-neuronal SNAP25-like 1
  • NipSnap1
  • protein NipSnap homolog 1

Background

NIPSNAP1 protein has a strong sequence similarity to the central portion of a hypothetical protein encoded by C. elegans chromosome III between a 4-nitrophenylphosphatase (NIP) domain and non-neuronal SNAP25-like protein. The NIPSNAP1 gene is located between the NF2 and pK1.3 genes on 22q12. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-58314
Species: Hu
Applications: IHC, IHC-P
NBP2-48615
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-76968
Species: Hu, Mu
Applications: ELISA, IF, IHC, IHC-P, WB
NBP2-45730
Species: Ca, Hu, Pm, Mu, Rt
Applications: ICC/IF, IF, IHC, IHC-P, WB
NBP1-74138
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB400-105
Species: Ca, Ch, ChHa, Eq, Ha, Hu, Mu, Md, Po, Pm, Rb, Rt
Applications: B/N, ChIP, Dual ISH-IHC, ELISA, Flow, GS, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, PCR, Simple Western, WB
NBP2-46256
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
H00004176-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, PLA, WB
NBP1-88769
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP2-45464
Species: Hu, Mu, Rt
Applications: IHC, WB
AF808
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, IHC, Neut, WB
NBP1-82588
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
H00004826-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NB100-60414
Species: Hu
Applications: IP, WB
NBP2-01064
Species: Hu, Pm, Mu, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-01819
Species: Hu
Applications: Flow, IHC, IHC-P, WB
NBP2-32582
Species: Hu
Applications: IHC, IHC-P, KD, WB
AF3470
Species: Hu
Applications: ICC, WB

Publications for NIPSNAP1 Antibody (H00008508-M15) (0)

There are no publications for NIPSNAP1 Antibody (H00008508-M15).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NIPSNAP1 Antibody (H00008508-M15) (0)

There are no reviews for NIPSNAP1 Antibody (H00008508-M15). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NIPSNAP1 Antibody (H00008508-M15) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NIPSNAP1 Products

Bioinformatics Tool for NIPSNAP1 Antibody (H00008508-M15)

Discover related pathways, diseases and genes to NIPSNAP1 Antibody (H00008508-M15). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NIPSNAP1 Antibody (H00008508-M15)

Discover more about diseases related to NIPSNAP1 Antibody (H00008508-M15).
 

Pathways for NIPSNAP1 Antibody (H00008508-M15)

View related products by pathway.

PTMs for NIPSNAP1 Antibody (H00008508-M15)

Learn more about PTMs related to NIPSNAP1 Antibody (H00008508-M15).
 

Research Areas for NIPSNAP1 Antibody (H00008508-M15)

Find related products by research area.

Blogs on NIPSNAP1

There are no specific blogs for NIPSNAP1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NIPSNAP1 Antibody (3B7) and receive a gift card or discount.

Bioinformatics

Gene Symbol NIPSNAP1
Entrez
Uniprot