NEU4 Antibody

Western Blot: NEU4 Antibody [NBP1-86278] - Analysis in control (vector only transfected HEK293T lysate) and NEU4 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunohistochemistry-Paraffin: NEU4 Antibody [NBP1-86278] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferus ducts.

Product Discontinued

NEU4 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: RRARLHMGIRLSQSPLDPRSWTEPWVIYEGPSGYSDLASIGPAPEGGLVFACLYESGARTSYDEISFCTFSLREVLENVPASPKPPNL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NEU4
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for NEU4 Antibody

• EC 3.2.1.18
• FLJ35928
• MGC102757
• MGC18222
• N-acetyl-alpha-neuraminidase 4
• neuraminidase 4
• sialidase 4
• sialidase-4

Background

NEU4 belongs to a family of glycohydrolytic enzymes which remove sialic acid residues from glycoproteins and glycolipids. [provided by RefSeq].

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NEU4