ND6 Antibody

Images

 
Western Blot: ND6 Antibody [NBP1-70650] - Human Lung lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ND6 Antibody Summary

Immunogen
Synthetic peptides corresponding to ND6(NADH dehydrogenase, subunit 6 (complex I)) The peptide sequence was selected from the middle region of ND6. Peptide sequence DGVVVVVNFNSVGSWMIYEGEGSGLIREDPIGAGALYDYGRWLVVVTGWT.
Specificity
This product is specific to Subunit or Isofrom: 6 (complex I).
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ND6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against ND6 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ND6 Antibody

  • mitochondrially encoded NADH dehydrogenase 6
  • MTND6
  • MT-ND6
  • NADH dehydrogenase subunit 6
  • NADH dehydrogenase, subunit 6 (complex I)
  • NADH6

Background

The exact function of ND6 remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00004535-Q01
Species: Hu
NBP2-24567
Species: Hu
Applications: WB
NBP1-79340
Species: Hu
Applications: WB
AF3014
Species: Hu
Applications: WB, IHC, Block
MAB7447
Species: Hu
Applications: WB, IHC
NB100-56503
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-25238
Species: Hu
Applications: Flow, ICC/IF, IHC-P, PAGE
NBP1-85500
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-70650
Species: Hu
Applications: WB

Publications for ND6 Antibody (NBP1-70650) (0)

There are no publications for ND6 Antibody (NBP1-70650).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ND6 Antibody (NBP1-70650) (0)

There are no reviews for ND6 Antibody (NBP1-70650). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ND6 Antibody (NBP1-70650) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ND6 Products

ND6 NBP1-70650

Bioinformatics Tool for ND6 Antibody (NBP1-70650)

Discover related pathways, diseases and genes to ND6 Antibody (NBP1-70650). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ND6 Antibody (NBP1-70650)

Discover more about diseases related to ND6 Antibody (NBP1-70650).
 

Pathways for ND6 Antibody (NBP1-70650)

View related products by pathway.

PTMs for ND6 Antibody (NBP1-70650)

Learn more about PTMs related to ND6 Antibody (NBP1-70650).

Blogs on ND6

There are no specific blogs for ND6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ND6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ND6