Recombinant Human NCKAP1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human NCKAP1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-110 of Human NCKAP1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MSRSVLQPSQQKLAEKLTILNDRGVGMLTRLYNIKKACGDPKAKPSYLIDKNLESAVKFIVRKFPAVETRNNNQQLAQLQKEKSEILKNLALYYFTFVDVMEFKDHVCEL

Protein/Peptide Type
Partial Recombinant Protein
Gene
NCKAP1

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human NCKAP1 Protein

  • FLJ11291
  • HEM2p125Nap1
  • KIAA0587
  • Membrane-associated protein HEM-2
  • MGC8981
  • NAP 1
  • NAP125
  • NAP1Nap1
  • NCK-associated protein 1

Background

NCKAP1 - NCK-associated protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-38049
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF5514
Species: Hu, Mu
Applications: WB
H00010097-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
AF1444
Species: Mu
Applications: WB, IHC
NBP1-30955
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-57026
Species: Hu
Applications: ICC/IF
NBP1-82761
Species: Hu
Applications: IHC, IHC-P
NBP1-81162
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-2307
Species: Hu
Applications: WB
NBP2-57502
Species: Hu
Applications: ICC/IF
NBP2-16060
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00008349-M06
Species: Hu
Applications: ELISA, IHC-P
NBP2-36543
Species: Hu
Applications: WB, IP
NB100-59845
Species: Hu
Applications: IP (-), WB, IHC-P
NB100-56346
Species: Hu, Mu
Applications: WB, ELISA, IHC-P
NBP1-58095
Species: Hu
Applications: WB
NBP2-07996
Species: Hu
NBP2-52486
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, ICC, IF
MAB208
Species: Hu
Applications: WB, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ICFlow, Neut, ELISA(Sta)
NB100-56705
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P

Publications for NCKAP1 Partial Recombinant Protein (H00010787-Q01) (0)

There are no publications for NCKAP1 Partial Recombinant Protein (H00010787-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NCKAP1 Partial Recombinant Protein (H00010787-Q01) (0)

There are no reviews for NCKAP1 Partial Recombinant Protein (H00010787-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NCKAP1 Partial Recombinant Protein (H00010787-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional NCKAP1 Products

Bioinformatics Tool for NCKAP1 Partial Recombinant Protein (H00010787-Q01)

Discover related pathways, diseases and genes to NCKAP1 Partial Recombinant Protein (H00010787-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NCKAP1 Partial Recombinant Protein (H00010787-Q01)

Discover more about diseases related to NCKAP1 Partial Recombinant Protein (H00010787-Q01).
 

Pathways for NCKAP1 Partial Recombinant Protein (H00010787-Q01)

View related products by pathway.

Research Areas for NCKAP1 Partial Recombinant Protein (H00010787-Q01)

Find related products by research area.

Blogs on NCKAP1

There are no specific blogs for NCKAP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

NCKAP1 Antibody
NBP1-83269

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human NCKAP1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol NCKAP1