NAT8L Antibody - BSA Free

Western Blot: NAT8L Antibody [NBP2-85358] - WB Suggested Anti-NAT8L Antibody. Titration: 1.0 ug/ml. Positive Control: HepG2 Whole Cell

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

NAT8L Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of NAT8L. Peptide sequence: VAAHKLYESLGFRHMGASDHYVLPGMTLSLAERLFFQVRYHRYRLQLREE The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NAT8L
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for NAT8L Antibody - BSA Free

• Camello-like protein 3
• CML3
• DKFZp434B0650
• DKFZp566H184
• EC 2.3.1.17
• FLJ37478
• Hcml3
• MGC117272
• NAA synthetase
• N-acetyltransferase 8-like (GCN5-related, putative)
• N-acetyltransferase 8-like protein
• N-acetyltransferase 8-like
• NAT8-LIKE

Background

N-Acetyltransferase 8-Like, NAT8L, is a single-pass membrane protein and a member of the N-Acetyltransferase superfamily. The protein catalyzes the synthesis of N-acetylaspartate (NAA), a major transport and storage enzyme that is specific to the nervous system. Mutations in NAT8L result in primary NAA deficiency.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NAT8L