NAT8L Antibody

Images

 
Western Blot: NAT8L Antibody [H00339983-B01P] - Analysis of FLJ37478 expression in transfected 293T cell line by FLJ37478 polyclonal antibody. Lane 1: FLJ37478 transfected lysate(14.74 KDa). Lane 2: Non-transfected ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

NAT8L Antibody Summary

Immunogen
FLJ37478 (NP_848652.1, 1 a.a. - 134 a.a.) full-length human protein. MADIEQYYMKPPGSCFWVAVLDGNVVGIVAARAHEEDNTVELLRMSVDSRFRGKGIAKALGRKVLEFAVVHNYSAVVLGTTAVKVAAHKLYESLGFRHMGASDHYVLPGMTLSLAERLFFQVRYHRYRLQLREE
Specificity
FLJ37478 - hypothetical protein LOC339983,
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
NAT8L
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
Application Notes
Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for NAT8L Antibody

  • Camello-like protein 3
  • CML3
  • DKFZp434B0650
  • DKFZp566H184
  • EC 2.3.1.17
  • FLJ37478
  • Hcml3
  • MGC117272
  • NAA synthetase
  • N-acetyltransferase 8-like (GCN5-related, putative)
  • N-acetyltransferase 8-like protein
  • N-acetyltransferase 8-like
  • NAT8-LIKE

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-47863
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-92803
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
DBD00
Species: Hu
Applications: ELISA
212-GD/CF
Species: Hu
Applications: Bind, BA
AF8198
Species: Hu
Applications: ELISA, IHC
NBP1-30475
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
640-A3
Species: Mu
Applications: Bind
NBP2-19581
Species: Hu, Mu, Rt
Applications: WB
NBP1-87730
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
H00057106-Q01
Species: Hu
Applications: ELISA, AP, PA, WB
H00057494-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP2-42864
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
AF4695
Species: Hu
Applications: ICC, IHC, WB
H00284716-P01
Species: Hu
Applications: ELISA, AP, PA, WB

Publications for NAT8L Antibody (H00339983-B01P) (0)

There are no publications for NAT8L Antibody (H00339983-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NAT8L Antibody (H00339983-B01P) (0)

There are no reviews for NAT8L Antibody (H00339983-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NAT8L Antibody (H00339983-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional NAT8L Products

Bioinformatics Tool for NAT8L Antibody (H00339983-B01P)

Discover related pathways, diseases and genes to NAT8L Antibody (H00339983-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NAT8L Antibody (H00339983-B01P)

Discover more about diseases related to NAT8L Antibody (H00339983-B01P).
 

Pathways for NAT8L Antibody (H00339983-B01P)

View related products by pathway.

PTMs for NAT8L Antibody (H00339983-B01P)

Learn more about PTMs related to NAT8L Antibody (H00339983-B01P).

Blogs on NAT8L

There are no specific blogs for NAT8L, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NAT8L Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NAT8L
Entrez
Uniprot