We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

NAP1 Recombinant Protein Antigen

Images

 
There are currently no images for NAP1 Protein (NBP2-33985PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

NAP1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TAB3.

Source: E. coli

Amino Acid Sequence: RKARRISVTSKVQADIHDTQAAAADEHRTGSTQSPRTQPRDEDYEGAPWNCDSCTFLNHPALNRCEQCEMPRYT

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
TAB3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-33985.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for NAP1 Recombinant Protein Antigen

  • CG5330
  • dNap
  • dNap1
  • dNAP-1
  • MAP3K7IP3
  • MGC45404
  • mitogen-activated protein kinase kinase kinase 7 interacting protein 3
  • Mitogen-activated protein kinase kinase kinase 7-interacting protein 3
  • NAP1
  • Nap-1
  • NF-kappa-B-activating protein 1
  • NFkB activating protein 1
  • p56/dCAF-4
  • TAB-3
  • TAK1-binding protein 3
  • TGF-beta activated kinase 1/MAP3K7 binding protein 3
  • TGF-beta-activated kinase 1 and MAP3K7-binding protein 3
  • TGF-beta-activated kinase 1-binding protein 3

Background

NAP1, also know as TAK1-binding protein 3 (TAB3), is a binding and regulatory subunit of the transforming growth factor-beta-activated kinase 1 (TAK1). NAP1 functions as an adaptor that mediates IL1 and TNF signaling pathways. Additionally it plays a role in the activation of the NF-kappaB pathway by functioning as receptors that bind polyubiquitin chains for the regulation of kinase activity.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-17155
Species: Hu
Applications: IHC,  IHC-P
AF5514
Species: Hu, Mu
Applications: WB
H00010097-M01
Species: Hu
Applications: ELISA, IHC,  IHC-P, S-ELISA, WB
NBP3-25708
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP1-81162
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
AF1444
Species: Mu
Applications: IHC, WB
NB100-93454
Species: Hu, Mu
Applications: ICC/IF, PEP-ELISA, WB
NBP3-03514
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P
NB100-56363
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP3-46947
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
NBP2-19491
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr,  IHC-P, WB
NBP3-48615
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-07996
Species: Hu
Applications: WB
NBP2-52486
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NB100-56705
Species: Bv, Ca, Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, KO, Simple Western, WB
NBP2-16060
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP2-33985PEP
Species: Hu
Applications: AC

Publications for NAP1 Protein (NBP2-33985PEP) (0)

There are no publications for NAP1 Protein (NBP2-33985PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NAP1 Protein (NBP2-33985PEP) (0)

There are no reviews for NAP1 Protein (NBP2-33985PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for NAP1 Protein (NBP2-33985PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional NAP1 Products

Array NBP2-33985PEP

Research Areas for NAP1 Protein (NBP2-33985PEP)

Find related products by research area.

Blogs on NAP1

There are no specific blogs for NAP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our NAP1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol TAB3