Recombinant Human Myosin 1E Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Myosin 1E Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 918 - 1014 of Human MYO1E partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:VSIGPGLPKNSRPTRRNTTQNTGYSSGTQNANYPVRAAPPPPGYHQNGVIRNQYVPYPHAPGSQRSNQKSLYTSMARPPLPRQQSTSSDRVSQTPES

Protein/Peptide Type
Partial Recombinant Protein
Gene
MYO1E

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Myosin 1E Protein

  • HuncM-IC
  • MGC104638
  • MYO1Cmyosin-IC
  • MYO1E variant protein
  • myosin IE
  • Myosin-Ic
  • myosin-Ie

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-14871
Species: Hu, Mu
Applications: WB, ICC/IF
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
NBP1-98474
Species: Hu
Applications: WB
NBP1-49533
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-87739
Species: Hu, Ch
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-87745
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-84548
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-02300
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP2-30003
Species: Hu
Applications: WB, ICC/IF, IHC-P
NBP2-30661
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-19452
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-31598
Species: Hu
Applications: IHC, IHC-P
NB600-279
Species: Hu, Mu
Applications: WB, IHC-P, IP
NB100-142
Species: Hu, Mu, Rt, Ch, Ha
Applications: WB, Simple Western, ChIP, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-2331
Species: Hu, Mu, Rt, Ca, Fi, Pl, Ze
Applications: WB, Simple Western, ELISA, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, SB
H00004643-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for Myosin 1E Partial Recombinant Protein (H00004643-Q01) (0)

There are no publications for Myosin 1E Partial Recombinant Protein (H00004643-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Myosin 1E Partial Recombinant Protein (H00004643-Q01) (0)

There are no reviews for Myosin 1E Partial Recombinant Protein (H00004643-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Myosin 1E Partial Recombinant Protein (H00004643-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Myosin 1E Products

Bioinformatics Tool for Myosin 1E Partial Recombinant Protein (H00004643-Q01)

Discover related pathways, diseases and genes to Myosin 1E Partial Recombinant Protein (H00004643-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Myosin 1E Partial Recombinant Protein (H00004643-Q01)

Discover more about diseases related to Myosin 1E Partial Recombinant Protein (H00004643-Q01).
 

Pathways for Myosin 1E Partial Recombinant Protein (H00004643-Q01)

View related products by pathway.

PTMs for Myosin 1E Partial Recombinant Protein (H00004643-Q01)

Learn more about PTMs related to Myosin 1E Partial Recombinant Protein (H00004643-Q01).

Blogs on Myosin 1E

There are no specific blogs for Myosin 1E, but you can read our latest blog posts.

Customers Who Bought This Also Bought

LC3A Antibody
NB100-2331
Mre11 Antibody
NB100-142

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Myosin 1E Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol MYO1E