Myoferlin Antibody

Western Blot: Myoferlin Antibody [H00026509-A01] - Analysis of FER1L3 expression in human stomach.

Product Discontinued

Myoferlin Antibody Summary

• Immunogen: FER1L3 (NP_038479, 655 a.a. - 754 a.a.) partial recombinant protein with GST tag. DAVNTLLAMAERLQTNIEALKSGIQGKIPANQLAELWLKLIDEVIEDTRYTLPLTEGKANVTVLDTQIRKLRSRSLSQIHEAAVRMRSEATDVKSTLAEI
• Specificity: FER1L3 - fer-1-like 3, myoferlin (C. elegans)
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: MYOF
• Purity: Unpurified

Applications/Dilutions

• Dilutions:
  • ELISA 1:100-1:2000
  • Immunocytochemistry/ Immunofluorescence 1:10-1:500
  • Immunohistochemistry 1:10-1:500
  • Western Blot 1:500
• Application Notes: Antibody reactive against tissue lysate and recombinant protein for western blot. It has also been used for ELISA. Immunocytochemistry/Immunofluorescence and Immunohistochemistry were reported in scientific literature.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: 50% Glycerol
• Preservative: No Preservative
• Purity: Unpurified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Myoferlin Antibody

• fer-1 (C.elegans)-like 3 (myoferlin)
• FER1L3
• fer-1-like 3, myoferlin (C. elegans)
• fer-1-like 3, myoferlin
• Fer-1-like protein 3
• FLJ36571
• FLJ90777
• KIAA1207
• myoferlin

Background

Mutations in dysferlin, a protein associated with the plasma membrane, can cause muscle weakness that affects both proximal and distal muscles. The protein encoded by this gene is a type II membrane protein that is structurally similar to dysferlin. It is a member of the ferlin family and associates with both plasma and nuclear membranes. The protein contains C2 domains that play a role in calcium-mediated membrane fusion events, suggesting that it may be involved in membrane regeneration and repair. Two transcript variants encoding different isoforms have been found for this gene. Other possible variants have been detected, but their full-length natures have not been determined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Myoferlin Antibody (H00026509-A01)(2)

Publications using H00026509-A01

• Sachen KL, Strohman MJ, Singletary J et al. Self-antigen recognition by follicular lymphoma B cell receptors Blood 2012-09-28 [PMID: 23024238]
• Lang CT, Markham KB, Behrendt NJ et al. Placental dysferlin expression is reduced in severe preeclampsia. Placenta 2009-08-01 [PMID: 19545895] (IF/IHC, WB, ICC/IF, Human)

FAQs for Myoferlin Antibody (H00026509-A01). (Showing 1 - 1 of 1 FAQs).

1. I have used the Myoferlin Antibody 0.05 ml, H00026509-A01, could you explain to me the bands stated on your website.
   • I believe the full length and the band at 173 kD are the canonical and an isoform 5 but I do not know what the 80 Kd band is.

Bioinformatics

• Gene Symbol: MYOF
• Entrez:
  • 26509(Human)
• OMIM:
  • 604603(Human)
• Uniprot:
  • NP_038479(Human)