MTMR12 Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MTMR12. Source: E. coli
Amino Acid Sequence: RPEEIHTNEKEVTEKEVTLHLLPGEQLLCEASTVLKYVQEDSCQHGVYGRLVCTDFKIAFLGDDESALDNDETQFKNKVIGENDITLHCVDQIYGVFDE Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
MTMR12 |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-13625. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
29 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for MTMR12 Recombinant Protein Antigen
Background
MTMR12, also known as Myotubularin-related protein 12, has 3 isoforms, a 747 amino acid isoform that is 86 kDa, a 693 amino acid isoform that is 80 kda and a 637 amino acid isoform that is 73 kDa, cytoplasm located, ubiquitous with prominent expression in brain, heart, kidney, placenta, and lung; acts as an adaptor subunit in a complex with an active PtdIns(3)P 3-phosphatase for the phosphatase myotubularin to regulate myotubularin intracellular location. Current research is being performed on this protein involvement in cri-u-chat syndrome, cervix uteri carcinoma in situ, pelvic inflammatory disease, centronuclear myopathy, gonorrhea, myopathy, and carcinoma. This protein has shown an interaction with MTMR2, MTM1, KBTBD7, and UBC proteins.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: IHC, IHC-P, PEP-ELISA, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, Single-Cell Western, WB
Species: Hu
Applications: ICC/IF
Species: Hu, Rt
Applications: ELISA, WB
Species: Hu
Applications: IHC, Simple Western, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC-P, WB
Species: Hu
Applications: PEP-ELISA, WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P
Species: Hu
Applications: ICC, WB
Species: Hu
Applications: CyTOF-ready, Flow, ICC, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: AC
Publications for MTMR12 Protein (NBP2-13625PEP) (0)
There are no publications for MTMR12 Protein (NBP2-13625PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for MTMR12 Protein (NBP2-13625PEP) (0)
There are no reviews for MTMR12 Protein (NBP2-13625PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for MTMR12 Protein (NBP2-13625PEP) (0)
Additional MTMR12 Products
Research Areas for MTMR12 Protein (NBP2-13625PEP)
Find related products by research area.
|
Blogs on MTMR12