Recombinant Human MTAP Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human MTAP Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 154 of Human MTAP full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MASGTTTTAVKIGIIGGTGLDDPEILEGRTEKYVDTPFGKPSDALILGKIKNVDCILLARHGRQHTIMPSKVNYQANIWALKEEGCTHVIVTTACGSLREEIQPGDIVIIDQFIDSHVRRACFPFTFHHDCFQRPPQKPSRSHCVSCATCRTMS

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
MTAP
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human MTAP Protein

  • 5'-methylthioadenosine phosphorylase
  • c86fus
  • EC 2.4.2.28
  • methylthioadenosine phosphorylase
  • MSAPMeSAdo phosphorylase
  • MTA phosphorylase
  • MTAPase
  • S-methyl-5'-thioadenosine phosphorylase

Background

MTAP( AAH18625, 1 a.a. - 155 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
MAB6798
Species: Hu
Applications: WB, ICC
NBP1-82454
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF6486
Species: Hu
Applications: WB, Simple Western
H00029107-M08
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-82805
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89519
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37507
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP2-32887
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, PAGE, IF
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-1793
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P, PEP-ELISA
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP2-15291
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00003451-D01P
Species: Hu, Rt
Applications: WB, ICC/IF
H00004507-P02
Species: Hu
Applications: WB, ELISA, PA

Publications for MTAP Recombinant Protein (H00004507-P02) (0)

There are no publications for MTAP Recombinant Protein (H00004507-P02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MTAP Recombinant Protein (H00004507-P02) (0)

There are no reviews for MTAP Recombinant Protein (H00004507-P02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MTAP Recombinant Protein (H00004507-P02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MTAP Products

Bioinformatics Tool for MTAP Recombinant Protein (H00004507-P02)

Discover related pathways, diseases and genes to MTAP Recombinant Protein (H00004507-P02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MTAP Recombinant Protein (H00004507-P02)

Discover more about diseases related to MTAP Recombinant Protein (H00004507-P02).
 

Pathways for MTAP Recombinant Protein (H00004507-P02)

View related products by pathway.

PTMs for MTAP Recombinant Protein (H00004507-P02)

Learn more about PTMs related to MTAP Recombinant Protein (H00004507-P02).

Blogs on MTAP

There are no specific blogs for MTAP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

p19ARF Antibody
NB200-106
MTAP Antibody (2G4)
H00004507-M01

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human MTAP Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol MTAP