MRPS6 Antibody

Images

 
Immunohistochemistry: MRPS6 Antibody [NBP2-30508] - Staining of human rectum shows strong granular cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MRPS6 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: KQPETAATLKRTIEALMDRGAIVRDLENLGERALPYRISAHSQQHNRGGYFLVDFYAPTAAVESMVEHLSRDIDVIRGNIVKHPLTQELKECEGIVPVPLAEKLYSTKKRKK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MRPS6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
MRPS6 Protein (NBP2-30508PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (83%), Rat (85%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MRPS6 Antibody

  • C21orf101
  • mitochondrial ribosomal protein S6
  • MRP-S6chromosome 21 open reading frame 101
  • RPMS628S ribosomal protein S6, mitochondrial
  • S6mt

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-02399
Species: Hu, Bt, Bv, Ca, Ha, Mk, Rb
Applications: IHC, IHC-P
NB100-1595
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP1-87799
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86687
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-13075
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
NBP1-86595
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-82648
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84975
Species: Hu
Applications: WB, IHC, IHC-P

Publications for MRPS6 Antibody (NBP2-30508) (0)

There are no publications for MRPS6 Antibody (NBP2-30508).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MRPS6 Antibody (NBP2-30508) (0)

There are no reviews for MRPS6 Antibody (NBP2-30508). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for MRPS6 Antibody (NBP2-30508) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MRPS6 Products

Bioinformatics Tool for MRPS6 Antibody (NBP2-30508)

Discover related pathways, diseases and genes to MRPS6 Antibody (NBP2-30508). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MRPS6 Antibody (NBP2-30508)

Discover more about diseases related to MRPS6 Antibody (NBP2-30508).
 

Pathways for MRPS6 Antibody (NBP2-30508)

View related products by pathway.

PTMs for MRPS6 Antibody (NBP2-30508)

Learn more about PTMs related to MRPS6 Antibody (NBP2-30508).

Blogs on MRPS6

There are no specific blogs for MRPS6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MRPS6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MRPS6
Uniprot