MRPS6 Antibody

Images

 
Western Blot: MRPS6 Antibody [NBP1-56962] - Jurkat cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MRPS6 Antibody Summary

Immunogen
Synthetic peptides corresponding to MRPS6 (mitochondrial ribosomal protein S6) The peptide sequence was selected from the middle region of MRPS6. Peptide sequence VESMVEHLSRDIDVIRGNIVKHPLTQELKECEGIVPVPLAEKLYSTKKRK.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MRPS6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against MRPS6 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for MRPS6 Antibody

  • C21orf101
  • mitochondrial ribosomal protein S6
  • MRP-S6chromosome 21 open reading frame 101
  • RPMS628S ribosomal protein S6, mitochondrial
  • S6mt

Background

Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein that belongs to the ribosomal protein S6P family. Pseudogenes corresponding to this gene are found on chromosomes 1p and 12q.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-02399
Species: Hu, Bt, Bv, Ca, Ha, Mk, Rb
Applications: IHC, IHC-P
NB100-1595
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP1-87799
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86687
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-13075
Species: Hu, Mu, Rt, Mk
Applications: WB, DB, ELISA, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NBP1-86595
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-82648
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-55231
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb, Ze
Applications: WB

Publications for MRPS6 Antibody (NBP1-56962) (0)

There are no publications for MRPS6 Antibody (NBP1-56962).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MRPS6 Antibody (NBP1-56962) (0)

There are no reviews for MRPS6 Antibody (NBP1-56962). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MRPS6 Antibody (NBP1-56962) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional MRPS6 Products

Bioinformatics Tool for MRPS6 Antibody (NBP1-56962)

Discover related pathways, diseases and genes to MRPS6 Antibody (NBP1-56962). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MRPS6 Antibody (NBP1-56962)

Discover more about diseases related to MRPS6 Antibody (NBP1-56962).
 

Pathways for MRPS6 Antibody (NBP1-56962)

View related products by pathway.

PTMs for MRPS6 Antibody (NBP1-56962)

Learn more about PTMs related to MRPS6 Antibody (NBP1-56962).

Blogs on MRPS6

There are no specific blogs for MRPS6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MRPS6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MRPS6
Uniprot