MRPL43 Antibody - Azide and BSA Free

Western Blot: MRPL43 Antibody [NBP2-93527] - Analysis of extracts of various cell lines, using MRPL43 at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 10s.

Immunocytochemistry/Immunofluorescence: MRPL43 Antibody [NBP2-93527] - Analysis of U-2 OS cells using MRPL43 at dilution of 1:100. Blue: DAPI for nuclear staining.

Immunocytochemistry/ Immunofluorescence: MRPL43 Antibody - Azide and BSA Free [NBP2-93527] - Immunofluorescence analysis of L929 cells using MRPL43 Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

MRPL43 Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Rabbit MRPL43 Antibody - Azide and BSA Free (NBP2-93527) is a polyclonal antibody validated for use in WB, ELISA and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 80-155 of human MRPL43 (NP_789762.1). LNGAVREESIHCKSVEEISTLVQKLADQSGLDVIRIRKPFHTDNPSIQGQWHPFTNKPTTFRGLRPREVQDPAPAQ
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MRPL43
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA Recommended starting concentration is 1 ug/mL
  • Immunocytochemistry/ Immunofluorescence 1:50-1:200
  • Western Blot 1:500-1:2000
• Theoretical MW: 23 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for MRPL43 Antibody - Azide and BSA Free

• 39S ribosomal protein L43, mitochondrial
• bMRP36a
• L43mt
• MGC17989
• MGC48892
• Mitochondrial ribosomal protein bMRP36a
• mitochondrial ribosomal protein L43
• MRP-L43

Background

MRPL43, also known as Mitochondrial Ribosomal Protein L43, contains several isoforms that are 23 kDa, 22 kDa, 18 kDa, and 17 kDa, and has been associated with protein synthesis in the mitochondria, though its specific function is still unknown. Current research is being conducted on MRPL43 and its connection to several diseases and disorders, including chronic progressive external ophthalmoplegia, prostatitis, Alzheimer's disease, and paraplegia. The protein interacts with ICT1, ARRB2, EIF1B, DDX56, and AARS2.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Bioinformatics

• Gene Symbol: MRPL43