MRPL42 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: MRPL42 Antibody [NBP1-83171] - Immunofluorescent staining of human cell line U-2 OS shows localization to plasma membrane & mitochondria.
Immunohistochemistry-Paraffin: MRPL42 Antibody [NBP1-83171] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MRPL42 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:YEHTKPIPRPDPVHNNEETHDQVLKTRLEEKVEHLEEGPMIEQLSKMFFTTKHRWYPHGRYHRCRKNLNPPKD
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MRPL42
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:20
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
MRPL42 Protein (NBP1-83171PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MRPL42 Antibody

  • 39S ribosomal protein L31, mitochondrial
  • 39S ribosomal protein L42, mitochondrial
  • HSPC204,28S ribosomal protein S32, mitochondrial
  • L31mt
  • mitochondrial ribosomal protein L42
  • mitochondrial ribosomal protein S32
  • MRPL31L42mt
  • MRP-L31MRP-S32
  • MRPS32MRP-L42
  • PTD007
  • RPML31S32mt

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-81545
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85286
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00006193-M02
Species: Hu, Mu, Rt, Pr
Applications: WB, ELISA, ICC/IF
NBP1-88570
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22298
Species: Hu, Mu
Applications: IP (-), WB, IHC-P
NBP1-31357
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84125
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02149
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-46191
Species: Hu, Mu
Applications: WB, IP
NB100-1032
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP2-46034
Species: Hu, Ca, Mk
Applications: WB, IHC

Publications for MRPL42 Antibody (NBP1-83171) (0)

There are no publications for MRPL42 Antibody (NBP1-83171).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MRPL42 Antibody (NBP1-83171) (0)

There are no reviews for MRPL42 Antibody (NBP1-83171). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for MRPL42 Antibody (NBP1-83171) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MRPL42 Products

Bioinformatics Tool for MRPL42 Antibody (NBP1-83171)

Discover related pathways, diseases and genes to MRPL42 Antibody (NBP1-83171). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Research Areas for MRPL42 Antibody (NBP1-83171)

Find related products by research area.

Blogs on MRPL42

There are no specific blogs for MRPL42, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MRPL42 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MRPL42