MRPL1 Antibody

Western Blot: MRPL1 Antibody [H00065008-B01P] - Analysis of MRPL1 expression in human liver.

Immunocytochemistry/Immunofluorescence: MRPL1 Antibody [H00065008-B01P] - Analysis of purified antibody to MRPL1 on HeLa cell. (antibody concentration 10 ug/ml)

Western Blot: MRPL1 Antibody [H00065008-B01P] - Analysis of MRPL1 expression in HeLa.

Western Blot: MRPL1 Antibody [H00065008-B01P] - Analysis of MRPL1 expression in transfected 293T cell line by MRPL1 polyclonal antibody. Lane 1: MRPL1 transfected lysate(33.33 KDa). Lane 2: Non-transfected lysate.

• Reactivity: Hu
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Mouse
• Conjugate: Unconjugated

MRPL1 Antibody Summary

• Immunogen: MRPL1 (AAH14356.1, 1 a.a. - 303 a.a.) full-length human protein. MVYQTSLCSCSVNIRVPNRHFAAATKSAKKTKKGAKEKTPDEKKDEIEKIKAYPYMEGEPEDDVYLKRLYPRQIYEVEKAVHLLKKFQILDFTSPKQSVYLDLTLDMALGKKKNVEPFTSVLSLPYPFASEINKVAVFTENASEVKIAEENGAAFAGGTSLIQKIWDDEIVADFYVAVPEIMPELNRLRKKLNKKYPKLSRNSIGRDIPKMLELFKNGHEIKVDEERENFLQTKIATLDMSSDQIAANLQAVINEVCRHRPLNLGPFVVRAFLRSSTSEGLLLKIDPLLPKEVKNEESEKEDA
• Specificity: MRPL1 - mitochondrial ribosomal protein L1,
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: MRPL1
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence
  • Western Blot 1:500
• Application Notes: Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control. It is also useful for immunofluoresence.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MRPL1 Antibody

• BM022
• FLJ96680
• L1MT
• mitochondrial ribosomal protein L1
• mitochondrial
• MRP-L1

Background

Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein that belongs to the L1 ribosomal protein family. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MRPL1
• Entrez:
  • 65008(Human)
• Uniprot:
  • AAH14356.1(Human)