MRGPRE Antibody - BSA Free

Western Blot: MRGPRE Antibody [NBP2-85312] - WB Suggested Anti-MRGPRE Antibody. Titration: 1.0 ug/ml. Positive Control: A549 Whole Cell

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

MRGPRE Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of MRGPRE. Peptide sequence: AAKPVVYFCLGSAQGRRLPLRLVLQRALGDEAELGAVRETSRRGLVDIAA The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MRGPRE
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for MRGPRE Antibody - BSA Free

• G protein-coupled receptor 167
• GPR167
• G-protein coupled receptor 167
• mas-related G protein-coupled MRGE
• MAS-related GPR, member E
• mas-related G-protein coupled receptor member E
• MRGE
• MRGEMGC138408
• MRGPRE

Background

MRGE is an orphan receptor that may regulate nociceptor function and/or development, including the sensation or modulation of pain.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MRGPRE