MRGPRE Antibody


Western Blot: MRGPRE Antibody [NBP2-85312] - WB Suggested Anti-MRGPRE Antibody. Titration: 1.0 ug/ml. Positive Control: A549 Whole Cell

Product Details

Reactivity Hu, RtSpecies Glossary
Applications WB

Order Details

MRGPRE Antibody Summary

The immunogen is a synthetic peptide directed towards the C-terminal region of MRGPRE. Peptide sequence: AAKPVVYFCLGSAQGRRLPLRLVLQRALGDEAELGAVRETSRRGLVDIAA The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Rat (91%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS, 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified

Alternate Names for MRGPRE Antibody

  • G protein-coupled receptor 167
  • GPR167
  • G-protein coupled receptor 167
  • mas-related G protein-coupled MRGE
  • MAS-related GPR, member E
  • mas-related G-protein coupled receptor member E
  • MRGE
  • MRGEMGC138408


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC, KO
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: WB, Flow, CyTOF-ready, ICC
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC
Species: Hu, Ha(-)
Applications: WB, ICC/IF, IHC, KD, Single-Cell Western
Species: Hu, Mu
Applications: IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC
Species: Hu
Applications: WB, Simple Western, IHC
Species: Hu, Pm
Applications: IHC, IHC-P, ICC
Species: Hu, Rt
Applications: WB

Publications for MRGPRE Antibody (NBP2-85312) (0)

There are no publications for MRGPRE Antibody (NBP2-85312).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MRGPRE Antibody (NBP2-85312) (0)

There are no reviews for MRGPRE Antibody (NBP2-85312). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MRGPRE Antibody (NBP2-85312) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional MRGPRE Products

Bioinformatics Tool for MRGPRE Antibody (NBP2-85312)

Discover related pathways, diseases and genes to MRGPRE Antibody (NBP2-85312). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Research Areas for MRGPRE Antibody (NBP2-85312)

Find related products by research area.

Blogs on MRGPRE

There are no specific blogs for MRGPRE, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our MRGPRE Antibody and receive a gift card or discount.


Gene Symbol MRGPRE