MPPED1 Antibody - BSA Free

Western Blot: MPPED1 Antibody [NBP2-93345] - Analysis of extracts of various cell lines, using MPPED1 at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 3s.

• Reactivity: Hu, Mu, Rt
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

MPPED1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit MPPED1 Antibody - BSA Free (NBP2-93345) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 277-326 of human MPPED1 (NP_001037835.1). PRLHVFGHIHEGYGVMADGTTTYVNASVCTVNYQPVNPPIVIDLPTPRNS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MPPED1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500-1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for MPPED1 Antibody - BSA Free

• Adult brain protein 239
• C22orf1MGC88045
• chromosome 22 open reading frame 1
• EC 3.1
• FAM1AFLJ78907
• FLJ50009
• FLJ54633,239ABFLJ59965
• metallophosphoesterase domain containing 1
• metallophosphoesterase domain-containing protein 1

Background

MPPED1 may have metallophosphoesterase activity (in vitro)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MPPED1