MMAA Antibody - BSA Free

Images

 
Western Blot: MMAA Antibody [NBP2-87809] - WB Suggested Anti-MMAA Antibody. Titration: 1.0 ug/ml. Positive Control: RPMI-8226 Whole Cell
Western Blot: MMAA Antibody [NBP2-87809] - Host: Rabbit. Target Name: MMAA. Sample Tissue: Human HCT116 Whole Cell. Antibody Dilution: 1ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free
Concentration
0.5 mg/ml

Order Details

MMAA Antibody - BSA Free Summary

Description
Novus Biologicals Rabbit MMAA Antibody - BSA Free (NBP2-87809) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of MMAA. Peptide sequence: GQRACLAEAITLVESTHSRKKELAQVLLQKVLLYHREQEQSNKGKPLAFR The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
MMAA
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Purity
Affinity purified

Alternate Names for MMAA Antibody - BSA Free

  • cblA
  • EC 3.6
  • methylmalonic aciduria (cobalamin deficiency) cblA type
  • methylmalonic aciduria (cobalamin deficiency) type A
  • MGC120011
  • MGC120012
  • MGC120013
  • mitochondrial

Background

MMAA is encoded by this gene is involved in the translocation of cobalamin into the mitochondrion, where it is used in the final steps of adenosylcobalamin synthesis. Adenosylcobalamin is a coenzyme required for the activity of methylmalonyl-CoA mutase. Defects in this gene are a cause of methylmalonic aciduria. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-03417
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, WB
NBP3-32113
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP2-37574
Species: Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-45884
Species: Hu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-71755
Species: Hu
Applications: CyTOF-ready, Flow, WB
NB100-791
Species: Hu, Mu
Applications: IHC,  IHC-P, PEP-ELISA, WB
NBP2-38351
Species: Hu
Applications: IHC,  IHC-P, WB
NB100-148
Species: Ch, Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, In vitro, KD, PLA, WB
NBP2-19804
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-57749
Species: Hu
Applications: IHC,  IHC-P, WB
NBP3-15261
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-45772
Species: Hu
Applications: IHC,  IHC-P, WB
AF8060
Species: Hu
Applications: WB
AF482
Species: Mu
Applications: IHC, WB
NBP2-33711
Species: Hu
Applications: IHC,  IHC-P
MAB41051
Species: Hu, Mu
Applications: WB
NBP1-88927
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB

Publications for MMAA Antibody (NBP2-87809) (0)

There are no publications for MMAA Antibody (NBP2-87809).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MMAA Antibody (NBP2-87809) (0)

There are no reviews for MMAA Antibody (NBP2-87809). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MMAA Antibody (NBP2-87809) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MMAA Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol MMAA