Recombinant Human MKKS Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human MKKS Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 471-570 of Human MKKS partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:DMKYGHLWSVQADSPCVANWPDLLSQCGCGLYNSQEELNWSFLRSTRRPFVPQSCLPHEAVGSASNLTLDCLTAKLSGLQVAVETANLILDLSYVIEDKN

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
MKKS

Applications/Dilutions

Dilutions
  • Western Blot Western Blot
Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human MKKS Protein

  • Bardet-Biedl syndrome 6 protein
  • BBS6MKS
  • HMCS
  • KMS
  • McKusick-Kaufman syndrome
  • McKusick-Kaufman/Bardet-Biedl syndromes putative chaperonin

Background

This gene encodes a protein with sequence similarity to the chaperonin family. The encoded protein may have a role in protein processing in limb, cardiac and reproductive system development. Mutations in this gene have been observed in patients with Bardet-Biedl syndrome type 6 and McKusick-Kaufman syndrome. Two transcript variants encoding the same protein have been identified for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-91695
Species: Hu
Applications: IHC, IHC-P
NBP2-34106
Species: Hu
Applications: IHC, IHC-P
NBP1-86248
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88690
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, ICC
NBP2-46722
Species: Hu
Applications: IHC, IHC-P
NBP1-06590
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-88688
Species: Hu
Applications: IHC, IHC-P
NBP1-32740
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-88689
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00166379-B01P
Species: Hu, Mu
Applications: WB, ELISA
NBP1-84403
Species: Hu
Applications: IHC, IHC-P
NBP1-88691
Species: Hu
Applications: WB, IHC, IHC-P
NB100-86991
Species: Hu, Mu
Applications: WB, ICC/IF, IP
NBP1-77933
Species: Hu, Mu, Rt, Bv, Ca, Ch, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
MAB6240
Species: Hu
Applications: WB, IHC
NB100-55268
Species: Hu
Applications: WB, IP
NBP1-87343
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP2-24614
Species: Hu, Mu, Rt, Op, Pm
Applications: WB

Publications for MKKS Partial Recombinant Protein (H00008195-Q01) (0)

There are no publications for MKKS Partial Recombinant Protein (H00008195-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MKKS Partial Recombinant Protein (H00008195-Q01) (0)

There are no reviews for MKKS Partial Recombinant Protein (H00008195-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MKKS Partial Recombinant Protein (H00008195-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MKKS Products

Bioinformatics Tool for MKKS Partial Recombinant Protein (H00008195-Q01)

Discover related pathways, diseases and genes to MKKS Partial Recombinant Protein (H00008195-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MKKS Partial Recombinant Protein (H00008195-Q01)

Discover more about diseases related to MKKS Partial Recombinant Protein (H00008195-Q01).
 

Pathways for MKKS Partial Recombinant Protein (H00008195-Q01)

View related products by pathway.

PTMs for MKKS Partial Recombinant Protein (H00008195-Q01)

Learn more about PTMs related to MKKS Partial Recombinant Protein (H00008195-Q01).

Blogs on MKKS

There are no specific blogs for MKKS, but you can read our latest blog posts.

Customers Who Bought This Also Bought

CEP290 Antibody
NB100-86991
MKKS Antibody
NBP1-92123

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human MKKS Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol MKKS