MFSD1 Antibody

Images

 
Western Blot: MFSD1 Antibody [NBP1-59624] - Human Adult Placenta, Antibody Dilution: 1.0 ug/ml.
Western Blot: MFSD1 Antibody [NBP1-59624] - HT1080 cell lysate, concentration 0.2-1 ug/ml.
Western Blot: MFSD1 Antibody [NBP1-59624] - Human Fetal Lung, Antibody Dilution: 1.0 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MFSD1 Antibody Summary

Immunogen
Synthetic peptides corresponding to MFSD1(major facilitator superfamily domain containing 1) The peptide sequence was selected from the middle region of MFSD1. Peptide sequence RFVFGIGGESLAVAQNTYAVSWFKGKELNLVFGLQLSMARIGSTVNMNLM.
Clonality
Polyclonal
Host
Rabbit
Gene
MFSD1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.2-1 ug/ml
Application Notes
This is a rabbit polyclonal antibody against MFSD1 and was validated on Western blot.

The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Theoretical MW
51 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for MFSD1 Antibody

  • FLJ14153
  • major facilitator superfamily domain containing 1
  • major facilitator superfamily domain-containing protein 1
  • SMAP4
  • SMAP-4
  • Smooth muscle cell-associated protein 4
  • UG0581B09

Background

The function of this protein remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-47607
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF366
Species: Hu
Applications: WB, ICC, Neut
NBP1-80734
Species: Hu
Applications: IHC, IHC-P
NBP1-79801
Species: Hu
Applications: WB
AF4885
Species: Mu
Applications: WB, IP
NBP1-54578
Species: Hu, Mu, Rt
Applications: WB, IHC-P, IP, PLA
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81224
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-30440
Species: Hu
Applications: IHC, IHC-P
NBP2-13346
Species: Hu
Applications: IHC, IHC-P
NBP1-82203
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-57998
Species: Hu
Applications: ICC/IF
NBP1-59440
Species: Hu
Applications: WB
NBP1-84164
Species: Hu
Applications: IHC, IHC-P
NBP2-14511
Species: Hu
Applications: WB, IHC, IHC-P

Publications for MFSD1 Antibody (NBP1-59624) (0)

There are no publications for MFSD1 Antibody (NBP1-59624).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MFSD1 Antibody (NBP1-59624) (0)

There are no reviews for MFSD1 Antibody (NBP1-59624). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MFSD1 Antibody (NBP1-59624) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MFSD1 Antibody Products

Related Products by Gene

Bioinformatics Tool for MFSD1 Antibody (NBP1-59624)

Discover related pathways, diseases and genes to MFSD1 Antibody (NBP1-59624). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on MFSD1

There are no specific blogs for MFSD1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MFSD1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MFSD1
Uniprot

Customers Who Bought This Also Bought