MFSD1 Antibody


Western Blot: MFSD1 Antibody [NBP1-59624] - Human Adult Placenta, Antibody Dilution: 1.0 ug/ml.
Western Blot: MFSD1 Antibody [NBP1-59624] - HT1080 cell lysate, concentration 0.2-1 ug/ml.
Western Blot: MFSD1 Antibody [NBP1-59624] - Human Fetal Lung, Antibody Dilution: 1.0 ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

MFSD1 Antibody Summary

Synthetic peptides corresponding to MFSD1(major facilitator superfamily domain containing 1) The peptide sequence was selected from the middle region of MFSD1. Peptide sequence RFVFGIGGESLAVAQNTYAVSWFKGKELNLVFGLQLSMARIGSTVNMNLM.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


  • Western Blot 0.2-1 ug/ml
Application Notes
This is a rabbit polyclonal antibody against MFSD1 and was validated on Western blot.

The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Theoretical MW
51 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for MFSD1 Antibody

  • FLJ14153
  • major facilitator superfamily domain containing 1
  • major facilitator superfamily domain-containing protein 1
  • SMAP4
  • SMAP-4
  • Smooth muscle cell-associated protein 4
  • UG0581B09


The function of this protein remains unknown.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ICC
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB
Species: Mu
Applications: WB, IP
Species: Hu, Mu, Rt
Applications: WB, IHC-P, IP, PLA
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu
Applications: WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB

Publications for MFSD1 Antibody (NBP1-59624) (0)

There are no publications for MFSD1 Antibody (NBP1-59624).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MFSD1 Antibody (NBP1-59624) (0)

There are no reviews for MFSD1 Antibody (NBP1-59624). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MFSD1 Antibody (NBP1-59624) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional MFSD1 Antibody Products

Related Products by Gene

Bioinformatics Tool for MFSD1 Antibody (NBP1-59624)

Discover related pathways, diseases and genes to MFSD1 Antibody (NBP1-59624). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on MFSD1

There are no specific blogs for MFSD1, but you can read our latest blog posts.

Contact Information

Product PDFs

Review this Product

Be the first to review our MFSD1 Antibody and receive a gift card or discount.


Gene Symbol MFSD1

Customers Who Bought This Also Bought
