MFAP3L Antibody


Western Blot: MFAP3L Antibody [NBP1-70637] - Titration: 2.5ug/ml Positive Control: Jurkat cell lysate.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

MFAP3L Antibody Summary

Synthetic peptides corresponding to MFAP3L(microfibrillar-associated protein 3-like) The peptide sequence was selected from the N terminal of MFAP3L. Peptide sequence MHDSGLLNITKVSFSDRGKYTCVASNIYGTVNNTVTLRVIFTSGDMGVYY.
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against MFAP3L and was validated on Western blot.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Protein A purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for MFAP3L Antibody

  • HSD39
  • HSD-39
  • MFAP3L
  • microfibrillar-associated protein 3-like
  • NYD-sp9
  • testis development protein NYD-SP9


The function remains unknown.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: IHC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready

Publications for MFAP3L Antibody (NBP1-70637) (0)

There are no publications for MFAP3L Antibody (NBP1-70637).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MFAP3L Antibody (NBP1-70637) (0)

There are no reviews for MFAP3L Antibody (NBP1-70637). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MFAP3L Antibody (NBP1-70637) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional MFAP3L Products

Bioinformatics Tool for MFAP3L Antibody (NBP1-70637)

Discover related pathways, diseases and genes to MFAP3L Antibody (NBP1-70637). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MFAP3L Antibody (NBP1-70637)

Discover more about diseases related to MFAP3L Antibody (NBP1-70637).

PTMs for MFAP3L Antibody (NBP1-70637)

Learn more about PTMs related to MFAP3L Antibody (NBP1-70637).

Blogs on MFAP3L

There are no specific blogs for MFAP3L, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our MFAP3L Antibody and receive a gift card or discount.


Gene Symbol MFAP3L