MFAP3 Antibody Summary
Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: EFARYIEELARSVPLPPLILNCRAFVEEMFEAVRVDDPDDLGERIKERPALNAQGGIYVINPEMGRSNSPGGDSDDGSLNEQGQEIAVQVSVHLQSETKSIDTESQGSSHFSPPDDIGSAESNCNYKDGA |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
MFAP3 |
Purity |
Immunogen affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunohistochemistry 1:20 - 1:50
- Immunohistochemistry-Paraffin 1:20 - 1:50
- Western Blot 0.04-0.4 ug/ml
|
Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
Control Peptide |
|
Reactivity Notes
Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (85%), Rat (85%)
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.2) and 40% Glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Immunogen affinity purified |
Alternate Names for MFAP3 Antibody
Background
MFAP3, also known as Microfibril-associated glycoprotein 3, has 2 isoforms, a 362 amino acid long isoform that is 40 kDa and a short 216 amino acid isoform that is 24 kDa, acts as a component of the elastin-associated microfibrils. Little is currently known about this protein disease involvement and interacting proteins.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
Species: Hu
Applications: IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Bv, Fe, Hu, Rb
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, KO, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P
Publications for MFAP3 Antibody (NBP1-86067) (0)
There are no publications for MFAP3 Antibody (NBP1-86067).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for MFAP3 Antibody (NBP1-86067) (0)
There are no reviews for MFAP3 Antibody (NBP1-86067).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for MFAP3 Antibody (NBP1-86067) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional MFAP3 Products
Bioinformatics Tool for MFAP3 Antibody (NBP1-86067)
Discover related pathways, diseases and genes to MFAP3 Antibody (NBP1-86067). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Diseases for MFAP3 Antibody (NBP1-86067)
Discover more about diseases related to MFAP3 Antibody (NBP1-86067).
|
Blogs on MFAP3