Methionine Sulfoxide Reductase B Antibody (8B2)

Images

 
Western Blot: Methionine Sulfoxide Reductase B Antibody (8B2) [H00051734-M02] - Analysis of SEPX1 expression in transfected 293T cell line by SEPX1 monoclonal antibody (M02), clone 8B2.Lane 1: SEPX1 transfected ...read more
Immunohistochemistry-Paraffin: Methionine Sulfoxide Reductase B Antibody (8B2) [H00051734-M02] - Analysis of monoclonal antibody to SEPX1 on formalin-fixed paraffin-embedded human placenta. Antibody concentration 1.5 ...read more
ELISA: Methionine Sulfoxide Reductase B Antibody (8B2) [H00051734-M02] - Detection limit for recombinant GST tagged SEPX1 is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IHC, IHC-P, S-ELISA
Clone
8B2
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Methionine Sulfoxide Reductase B Antibody (8B2) Summary

Immunogen
SEPX1 (NP_057416, 1 a.a. ~ 84 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MSFCSFFGGEVFQNHFEPGVYVCAKCGYELFSSRSKYAHSSPWPAFTETIHADSVAKRPEHNRSEALKVSCGKCGNGLGHEFLN
Specificity
SEPX1 (8B2)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
MSRB1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Sandwich ELISA
Application Notes
Antibody reactive against transfected lysate and recombinant protein for western blot. It has also been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Methionine Sulfoxide Reductase B Antibody (8B2)

  • EC 1.8.4.-
  • methionine sulfoxide reductase
  • methionine-R-sulfoxide reductase B1
  • MGC3344
  • MsrB1
  • MSRB1selenoprotein R
  • Selenoprotein X
  • selenoprotein X, 1
  • SELR
  • SELX

Background

This gene encodes a selenoprotein, which contains a selenocysteine (Sec) residue at its active site. The selenocysteine is encoded by the UGA codon that normally signals translation termination. The 3' UTR of selenoprotein genes have a common stem-loop structure, the sec insertion sequence (SECIS), that is necessary for the recognition of UGA as a Sec codon rather than as a stop signal. This protein belongs to the methionine sulfoxide reductase B (MsrB) family, and it is expressed in a variety of adult and fetal tissues.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-86594
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-87456
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-52983
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-84259
Species: Hu
Applications: WB, IHC, IHC-P
H00055697-B01P
Species: Hu
Applications: WB, ICC/IF
NBP1-86120
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90979
Species: Hu
Applications: IHC, IHC-P
AF5724
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-20619
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56708
Species: Hu, Mu, Rt, Po, Ch, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, HEStain, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, IHC-FrFl, KD, KO
NBP1-86919
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-13731
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-57749
Species: Hu
Applications: WB, IHC, IHC-P
H00728695-B01P
Species: Hu
Applications: WB, ICC/IF, IP
NBP1-88927
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-76933
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P

Publications for Methionine Sulfoxide Reductase B Antibody (H00051734-M02) (0)

There are no publications for Methionine Sulfoxide Reductase B Antibody (H00051734-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Methionine Sulfoxide Reductase B Antibody (H00051734-M02) (0)

There are no reviews for Methionine Sulfoxide Reductase B Antibody (H00051734-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Methionine Sulfoxide Reductase B Antibody (H00051734-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Methionine Sulfoxide Reductase B Products

Bioinformatics Tool for Methionine Sulfoxide Reductase B Antibody (H00051734-M02)

Discover related pathways, diseases and genes to Methionine Sulfoxide Reductase B Antibody (H00051734-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Methionine Sulfoxide Reductase B Antibody (H00051734-M02)

Discover more about diseases related to Methionine Sulfoxide Reductase B Antibody (H00051734-M02).
 

Pathways for Methionine Sulfoxide Reductase B Antibody (H00051734-M02)

View related products by pathway.

PTMs for Methionine Sulfoxide Reductase B Antibody (H00051734-M02)

Learn more about PTMs related to Methionine Sulfoxide Reductase B Antibody (H00051734-M02).

Blogs on Methionine Sulfoxide Reductase B

There are no specific blogs for Methionine Sulfoxide Reductase B, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Methionine Sulfoxide Reductase B Antibody (8B2) and receive a gift card or discount.

Bioinformatics

Gene Symbol MSRB1
Entrez
OMIM
Uniprot