Methionine Sulfoxide Reductase B Antibody (8B2) Summary
Immunogen |
SEPX1 (NP_057416, 1 a.a. ~ 84 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MSFCSFFGGEVFQNHFEPGVYVCAKCGYELFSSRSKYAHSSPWPAFTETIHADSVAKRPEHNRSEALKVSCGKCGNGLGHEFLN |
Specificity |
SEPX1 (8B2) |
Isotype |
IgG1 Kappa |
Clonality |
Monoclonal |
Host |
Mouse |
Gene |
MSRB1 |
Purity |
IgG purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- ELISA
- Immunohistochemistry
- Immunohistochemistry-Paraffin
- Western Blot 1:500
|
Application Notes |
Antibody reactive against transfected lysate and recombinant protein for western blot. It has also been used for ELISA. |
Packaging, Storage & Formulations
Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer |
In 1x PBS, pH 7.4 |
Preservative |
No Preservative |
Purity |
IgG purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for Methionine Sulfoxide Reductase B Antibody (8B2)
Background
This gene encodes a selenoprotein, which contains a selenocysteine (Sec) residue at its active site. The selenocysteine is encoded by the UGA codon that normally signals translation termination. The 3' UTR of selenoprotein genes have a common stem-loop structure, the sec insertion sequence (SECIS), that is necessary for the recognition of UGA as a Sec codon rather than as a stop signal. This protein belongs to the methionine sulfoxide reductase B (MsrB) family, and it is expressed in a variety of adult and fetal tissues.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ICC, WB
Species: Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC, IHC
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu(-)
Applications: WB
Species: Hu
Applications: ICC/IF, IP, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: WB
Publications for Methionine Sulfoxide Reductase B Antibody (H00051734-M02) (0)
There are no publications for Methionine Sulfoxide Reductase B Antibody (H00051734-M02).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Methionine Sulfoxide Reductase B Antibody (H00051734-M02) (0)
There are no reviews for Methionine Sulfoxide Reductase B Antibody (H00051734-M02).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Methionine Sulfoxide Reductase B Antibody (H00051734-M02) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Methionine Sulfoxide Reductase B Products
Bioinformatics Tool for Methionine Sulfoxide Reductase B Antibody (H00051734-M02)
Discover related pathways, diseases and genes to Methionine Sulfoxide Reductase B Antibody (H00051734-M02). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Diseases for Methionine Sulfoxide Reductase B Antibody (H00051734-M02)
Discover more about diseases related to Methionine Sulfoxide Reductase B Antibody (H00051734-M02).
| | Pathways for Methionine Sulfoxide Reductase B Antibody (H00051734-M02)
View related products by pathway.
|
PTMs for Methionine Sulfoxide Reductase B Antibody (H00051734-M02)
Learn more about PTMs related to Methionine Sulfoxide Reductase B Antibody (H00051734-M02).
| | Research Areas for Methionine Sulfoxide Reductase B Antibody (H00051734-M02)
Find related products by research area.
|
Blogs on Methionine Sulfoxide Reductase B