Recombinant Human MED15 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human MED15 Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 88 of Human PCQAP partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MDVSGQETDWRSTAFRQKLVSQIEDAMRKAGVAHSKSSKDMESHVFLKAKTRDEYLSLVARLIIHFRDIHNKKSQASVSDPMNALQSL

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
MED15
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human MED15 Protein

  • ARC105Arc105
  • CAG7A
  • CTG repeat protein 7a
  • CTG7A
  • FLJ42282
  • FLJ42935
  • mediator complex subunit 15PC2 glutamine/Q-rich-associated protein
  • mediator of RNA polymerase II transcription subunit 15
  • PC2 (positive cofactor 2, multiprotein complex) glutamine/Q-rich-associatedprotein
  • PC2-glutamine-rich-associated protein
  • PCQAPDKFZp686A2214
  • Positive cofactor 2 glutamine/Q-rich-associated protein
  • positive cofactor 2, glutamine/Q-rich-associated protein
  • TIG1DKFZp762B1216
  • TIG-1TPA-inducible gene 1 protein
  • TNRC7
  • TPA inducible gene-1
  • TPA inducible protein
  • trinucleotide repeat containing 7,105-kD
  • Trinucleotide repeat-containing gene 7 protein

Background

PCQAP - PC2 (positive cofactor 2, multiprotein complex) glutamine/Q-rich-associated protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-46076
Species: Hu
Applications: WB, IHC
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-16756
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-00637
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF4885
Species: Mu
Applications: WB, IP
AF636
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP2-03644
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-689
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP1-56929
Species: Hu
Applications: WB, IHC, IHC-P
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-1939
Species: Hu, Mu, Rt, Av
Applications: WB, EIA, Flow, IHC, IHC-Fr, IHC-P, IF
NBP1-26616
Species: Hu
Applications: WB, IP
NBL1-15556
Species: Hu
NB100-381
Species: Hu
Applications: WB, ChIP, IP, PLA
NBP2-24530
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P, Flow-IC
H00051586-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for MED15 Partial Recombinant Protein (H00051586-Q01) (0)

There are no publications for MED15 Partial Recombinant Protein (H00051586-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MED15 Partial Recombinant Protein (H00051586-Q01) (0)

There are no reviews for MED15 Partial Recombinant Protein (H00051586-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MED15 Partial Recombinant Protein (H00051586-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MED15 Products

Bioinformatics Tool for MED15 Partial Recombinant Protein (H00051586-Q01)

Discover related pathways, diseases and genes to MED15 Partial Recombinant Protein (H00051586-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MED15 Partial Recombinant Protein (H00051586-Q01)

Discover more about diseases related to MED15 Partial Recombinant Protein (H00051586-Q01).
 

Pathways for MED15 Partial Recombinant Protein (H00051586-Q01)

View related products by pathway.

PTMs for MED15 Partial Recombinant Protein (H00051586-Q01)

Learn more about PTMs related to MED15 Partial Recombinant Protein (H00051586-Q01).

Blogs on MED15.

TAZ Antibody: The Devil is in the Details
WW domain-containing transcription regulator protein 1 also known as WWTR1 and TAZ, is a 44KDa protein that acts as a downstream regulatory target in the Hippo signaling pathway. This protein undergoes post-translational modification and becomes phosp...  Read full blog post.

Customers Who Bought This Also Bought

MED15 Antibody
NBP1-89018
p19ARF Antibody
NB200-106

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human MED15 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol MED15