MDS2 Antibody

Images

 
Immunohistochemistry-Paraffin: MDS2 Antibody [NBP2-14774] Staining of human kidney shows moderate nuclear and cytoplasmic positivity in tubules.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MDS2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the amino acids: FIERTETAGELSRGLIGVLSSQISWCLLNVNLSKLPTRLQRLSCSVLNSSPAMRGGARGRPQLTL
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MDS2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
MDS2 Protein (NBP2-14774PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MDS2 Antibody

  • MDS2 myelodysplastic syndrome 2 translocation associated
  • RP11-223J15.1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-80695
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AF-252-PB
Species: Hu
Applications: IHC, WB
NBP2-45545
Species: Hu, Mu, Rt
Applications: IHC, WB
NBP3-12196
Species: Hu, Mu, Rt
Applications: DB, ELISA, IHC, IHC-P, IP, WB
NBP2-91988
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-85525
Species: Hu
Applications: IHC, IHC-P, WB
H00000302-M02
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IP, WB
NBP2-24589
Species: Bv, Ca, Eq, Hu, Mu, Pm
Applications: IB, IHC, IHC-P, KO, WB

Publications for MDS2 Antibody (NBP2-14774) (0)

There are no publications for MDS2 Antibody (NBP2-14774).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MDS2 Antibody (NBP2-14774) (0)

There are no reviews for MDS2 Antibody (NBP2-14774). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for MDS2 Antibody (NBP2-14774) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MDS2 Products

Array NBP2-14774

Diseases for MDS2 Antibody (NBP2-14774)

Discover more about diseases related to MDS2 Antibody (NBP2-14774).

Blogs on MDS2

There are no specific blogs for MDS2, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MDS2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MDS2