MCTP1 Antibody

Western Blot: MCTP1 Antibody [NBP1-83604] - miR-206 post-transcriptionally regulates MCTP1 and Rarb and elevates apoptotic cell death. d) miR-206 controlled MCTP1 and Rarb protein expression. Empty vector served as a negative control (Cont). Image collected and cropped by CiteAb from the following publication (//www.ncbi.nlm.nih.gov/pmc/articles/PMC7328278/) licensed under a CC-BY license.

Immunocytochemistry/Immunofluorescence: MCTP1 Antibody [NBP1-83604] - Immunofluorescent staining of human cell line PC-3 shows localization to nucleoplasm & cytosol.

Immunohistochemistry-Paraffin: MCTP1 Antibody [NBP1-83604] - Staining of human stomach shows strong cytoplasmic and membranous positivity in glandular cells.

Western Blot: MCTP1 Antibody [NBP1-83604] - MCTP1 regulates Hif-1 alpha (NB100-449) and reduces apoptosis in mtNSC-34 cells. a) Overexpressed MCTP1 decreased Hif-1 alpha and Mef2c proteins. Both Mctp1 and Rarb expression were increased by MCTP1. Downregulated Bax and upregulated Bcl2 by MCTP1 diminished apoptosis in mtNSC-34 cells. Empty vector served as a negative control (Cont). Image collected and cropped by CiteAb from the following publication (//www.ncbi.nlm.nih.gov/pmc/articles/PMC7328278/) licensed under a CC-BY license.

Defective p53 activity leads to failure of the BER coordination system. (A) High-throughput microscopy analysis of TIG-1 cells transfected with plasmids expressing wild-type or mutant p53. Boxplots showing the distribution of APE1 staining intensity (in arbitrary units) in p53 low versus p53 overexpressing cells. Each p53 mutant is reported on top of the relevant plot. The dashed line highlights the median APE1 intensity in p53 low cells (N > 5000). NS: not statistically significant at P < 0.05. (B) Representative western blotting analysis comparing WI38 and WI38 (SV40) cells upon transfection with the indicated siRNAs. Failure to downregulate Sp1 correlates with the inability to modulate APE1. Actin was used as loading control. (C) qPCR analysis on APE1 transcript in WI38 and WI38 (SV40) cells upon transfection with the indicated siRNAs. APE1 transcription is reduced in WI38 cells only. Note the higher transcript content in WI38 (SV40) cells. (D) Representative Western blotting analysis comparing WI38 and WI38 (SV40) cells upon transfection with the indicated siRNAs. Failure to modulate BER correlates with gamma H2AX staining in WI38 (SV40) cells; gamma H2AX increases further upon XRCC1 depletion. (E) Neutral Comet assay on WI38 and WI38 (SV40) fibroblasts shows accumulation of DSBs upon XRCC1-depletion in transformed cells only. Results are expressed as mean ± SD of three independent experiments. Image collected and cropped by CiteAb from the following open publication (//academic.oup.com/nar/article-lookup/doi/10.1093/nar/gkw015), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Product Discontinued

MCTP1 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: VFDYDFGLQDDFMGSAFLDLTQLELNRPTDVTLTLKDPHYPDHDLGIILLSVILTPKEGESRDVTMLMRKSWKRSSKFQTQSLRLSDLHRKSHLWRGIVSITLIEGRDLKAMDSNGLSDPYVKFRLGH
• Predicted Species: Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MCTP1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot Image collected and cropped by CiteAb from the following publication (https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7328278/) licensed under a CC-BY license.
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for MCTP1 Antibody

• FLJ22344
• multiple C2 and transmembrane domain-containing protein 1
• multiple C2 domains, transmembrane 1
• multiple C2-domains with two transmembrane regions 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for MCTP1 Antibody (NBP1-83604)(1)

Publication using NBP1-83604

• Kim KY, Kim YR, Choi KW et al. Downregulated miR-18b-5p triggers apoptosis by inhibition of calcium signaling and neuronal cell differentiation in transgenic SOD1 (G93A) mice and SOD1 (G17S and G86S) ALS patients Transl Neurodegener 2020-07-01 [PMID: 32605607]

Bioinformatics

• Gene Symbol: MCTP1