MCTP1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: MCTP1 Antibody [NBP1-83604] - Immunofluorescent staining of human cell line PC-3 shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: MCTP1 Antibody [NBP1-83604] - Staining of human stomach shows strong cytoplasmic and membranous positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MCTP1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:VFDYDFGLQDDFMGSAFLDLTQLELNRPTDVTLTLKDPHYPDHDLGIILLSVILTPKEGESRDVTMLMRKSWKRSSKFQTQSLRLSDLHRKSHLWRGIVSITLIEGRDLKAMDSNGLSDPYVKFRLGH
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MCTP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
MCTP1 Protein (NBP1-83604PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MCTP1 Antibody

  • FLJ22344
  • multiple C2 and transmembrane domain-containing protein 1
  • multiple C2 domains, transmembrane 1
  • multiple C2-domains with two transmembrane regions 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-92462
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-83393
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-83099
Species: Hu
Applications: IHC, IHC-P
NBP1-77112
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
NBP1-90507
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87936
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00006193-M02
Species: Hu, Mu, Rt, Pr
Applications: WB, ELISA, ICC/IF
NBP2-15020
Species: Hu
Applications: WB, ICC/IF
NBP1-81782
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-221
Species: Hu, Mu, Rt, Po, Av, Bv, Ch, Eq, Ha, Op, Pm, Sh, Ze
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IP
AF1638
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
NBP1-88802
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-42686
Species: Hu
Applications: WB (-), IHC, IP
AF7035
Species: Hu
Applications: IHC
NBP1-82162
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-93705
Species: Hu
Applications: IHC, IHC-P
NBP2-58275
Species: Hu
Applications: WB, ICC/IF
NBP1-83604
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for MCTP1 Antibody (NBP1-83604) (0)

There are no publications for MCTP1 Antibody (NBP1-83604).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MCTP1 Antibody (NBP1-83604) (0)

There are no reviews for MCTP1 Antibody (NBP1-83604). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for MCTP1 Antibody (NBP1-83604) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MCTP1 Products

Bioinformatics Tool for MCTP1 Antibody (NBP1-83604)

Discover related pathways, diseases and genes to MCTP1 Antibody (NBP1-83604). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MCTP1 Antibody (NBP1-83604)

Discover more about diseases related to MCTP1 Antibody (NBP1-83604).
 

Pathways for MCTP1 Antibody (NBP1-83604)

View related products by pathway.

Blogs on MCTP1

There are no specific blogs for MCTP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MCTP1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MCTP1