MAP3K15 Antibody (1H7) - Azide and BSA Free

ELISA: MAP3K15 Antibody (1H7) [H00389840-M02] - Detection limit for recombinant GST tagged MAP3K15 is 0.3 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 1H7
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

MAP3K15 Antibody (1H7) - Azide and BSA Free Summary

• Immunogen: MAP3K15 (NP_001001671, 691 a.a. ~ 786 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LYHLQLKLKSNCITENPAGPYGQRTDKELIDWLRLQGADAKTIEKIVEEGYTLSDILNEITKEDLRYLRLRGGLLCRLWSAVSQYRRAQEASETKD
• Specificity: MAP3K15 - mitogen-activated protein kinase kinase kinase 15 (1H7)
• Isotype: IgG2b Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: MAP3K15
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot 1:500
• Application Notes: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MAP3K15 Antibody (1H7) - Azide and BSA Free

• Apoptosis signal-regulating kinase 3
• ASK3MEKK 15
• bA723P2.3
• EC 2.7.11
• EC 2.7.11.25
• FLJ16518
• MAPK/ERK kinase kinase 15
• MEK kinase 15
• mitogen-activated protein kinase kinase kinase 15

Background

MAP3K15 (Mitogen-Activated Protein Kinase Kinase Kinase 15) belongs to the MAPK family which have a variety of roles including proliferation regulation, activation of gene transcription and differentiation. MAP3K15 is known to interact with PRKAB2 and has been studied in relation to neuronitis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MAP3K15
• Entrez:
  • 389840(Human)
• Uniprot:
  • NP_001001671(Human)