MAP3K12 binding inhibitory protein 1 Recombinant Protein Antigen

Images

 
There are currently no images for MAP3K12 binding inhibitory protein 1 Protein (NBP1-85805PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

MAP3K12 binding inhibitory protein 1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MBIP.

Source: E. coli

Amino Acid Sequence: DCNQENSCARTDAIFTPYPGFKSHVKVSRVVNTYGPQTRPEGIPGSGHKPNSMLRDCGNQAVEERLQNIEAHLRLQTGGPVPRDIYQRIKKLEDKILELEGISPEYFQSVSFSGKRRKVQPPQQNY

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
MBIP
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-85805.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for MAP3K12 binding inhibitory protein 1 Recombinant Protein Antigen

  • MAP3K12 binding inhibitory protein 1
  • MAP3K12-binding inhibitory protein 1
  • MAPK upstream kinase-binding inhibitory protein
  • MUK-binding inhibitory protein

Background

MAP3K12 binding inhibitory protein 1 inhibits the MAP3K12 activity to induce the activation of the JNK/SAPK pathway. Component of the ATAC complex, a complex with histone acetyltransferase activity on histones H3 and H4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-17218
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr,  IHC-P, Simple Western, WB
NBP2-44501
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IF, IHC,  IHC-P
MAB17761
Species: Hu, Mu, Rt
Applications: ICC, WB
NBP1-83889
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
423-F8
Species: Hu, Mu
Applications: BA
NBP1-62178
Species: Hu, Mu, Rt
Applications: ELISA
AF4984
Species: Hu
Applications: ChIP, CyTOF-ready, ICC, ICFlow, Simple Western, WB
NB100-2439
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, PEP-ELISA, WB
AF486
Species: Mu
Applications: IHC, Neut, WB
AF3690
Species: Hu, Mu
Applications: ChIP, ICC, WB
DY1707
Species: Hu
Applications: ELISA
NBP2-52452
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IHC,  IHC-P, WB
AF8277
Species: Mu
Applications: CyTOF-ready, Flow, IHC, WB
NBP1-06274
Species: Ce, Ch, Dr, Hu, Mu, Rt, Sh, Ze
Applications: Flow, ICC/IF, IHC-FrFl, IHC,  IHC-P, Simple Western, WB
NBP1-87404
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB

Publications for MAP3K12 binding inhibitory protein 1 Protein (NBP1-85805PEP) (0)

There are no publications for MAP3K12 binding inhibitory protein 1 Protein (NBP1-85805PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MAP3K12 binding inhibitory protein 1 Protein (NBP1-85805PEP) (0)

There are no reviews for MAP3K12 binding inhibitory protein 1 Protein (NBP1-85805PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for MAP3K12 binding inhibitory protein 1 Protein (NBP1-85805PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MAP3K12 binding inhibitory protein 1 Products

Research Areas for MAP3K12 binding inhibitory protein 1 Protein (NBP1-85805PEP)

Find related products by research area.

Blogs on MAP3K12 binding inhibitory protein 1

There are no specific blogs for MAP3K12 binding inhibitory protein 1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our MAP3K12 binding inhibitory protein 1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol MBIP