MANSC1 Antibody

Images

 
Western Blot: MANSC1 Antibody [NBP2-85251] - WB Suggested Anti-MANSC1 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: Human kidney
Immunohistochemistry: MANSC1 Antibody [NBP2-85251] - Human Muscle

Product Details

Summary
Reactivity Hu, Mu, Rt, Ca, EqSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MANSC1 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of human MANSC1. Peptide sequence: LTLRLSASQNCLKKSLEDVVIDIQSSLSKGIRGNEPVYTSTQEDCINSCC The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Mouse (90%), Rat (90%), Canine (90%), Equine (92%). Backed by our 100% Guarantee.
Clonality
Polyclonal
Host
Rabbit
Gene
MANSC1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MANSC1 Antibody

  • 9130403P13Rik
  • LOH12CR3FLJ10298
  • Loss of heterozygosity 12 chromosomal region 3 protein
  • MANSC domain containing 1
  • MANSC domain-containing protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1555
Species: Hu
Applications: WB
NBP1-80695
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80616
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-03198
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-P
NBP2-24501
Species: Hu, Mu, Bv, Pm
Applications: WB, IHC, IHC-P
NBP1-84745
Species: Hu
Applications: IHC, IHC-P
1505-LR
Species: Hu
NBP1-90949
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-86200
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-30597
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-47560
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-85251
Species: Hu, Mu, Rt, Ca, Eq
Applications: WB, IHC, IHC-P

Publications for MANSC1 Antibody (NBP2-85251) (0)

There are no publications for MANSC1 Antibody (NBP2-85251).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MANSC1 Antibody (NBP2-85251) (0)

There are no reviews for MANSC1 Antibody (NBP2-85251). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MANSC1 Antibody (NBP2-85251) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional MANSC1 Products

Bioinformatics Tool for MANSC1 Antibody (NBP2-85251)

Discover related pathways, diseases and genes to MANSC1 Antibody (NBP2-85251). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MANSC1 Antibody (NBP2-85251)

Discover more about diseases related to MANSC1 Antibody (NBP2-85251).
 

Pathways for MANSC1 Antibody (NBP2-85251)

View related products by pathway.

Blogs on MANSC1

There are no specific blogs for MANSC1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MANSC1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MANSC1