Recombinant Human MAGEB1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human MAGEB1 Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 86 - 195 of Human MAGEB1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:QGEENASFSQATTSTESSVKDPVAWEAGMLMHFILRKYKMREPIMKADMLKVVDEKYKDHFTEILNGASRRLELVFGLDLKEDNPSGHTYTLVSKLNLTNDGNLSNDWDF

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
MAGEB1

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human MAGEB1 Protein

  • Cancer/testis antigen 3.1
  • CT3.1cancer/testis antigen family 3, member 1
  • DAM10MAGE-B1 antigen
  • DSS/AHC critical interval MAGE superfamily 10
  • DSS-AHC critical interval MAGE superfamily 10
  • MAGEL1MAGE-XP antigen
  • MAGEXP
  • MAGE-Xp
  • melanoma antigen family B, 1
  • melanoma-associated antigen B1
  • MGC9322

Background

This gene is a member of the MAGEB gene family. The members of this family have their entire coding sequences located in the last exon, and the encoded proteins show 50 to 68% sequence identity to each other. The promoters and first exons of the MAGEB genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. This gene is localized in the DSS (dosage-sensitive sex reversal) critical region, and expressed in testis and in a significant fraction of tumors of various histological types. This gene and other MAGEB members are clustered on chromosome Xp22-p21. Multiple alternatively spliced transcript variants encoding the same protein have been found for this gene, however, the full length nature of some variants has not been defined. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-29469
Species: Hu, Rt, Ca
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-02553
Species: Hu
Applications: ELISA, IHC, IHC-P
PP-H7431-00
Species: Hu
Applications: WB
NBP2-45719
Species: Hu
Applications: WB, IHC
NBP2-45722
Species: Hu
Applications: WB, IHC
NB100-1607
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-25238
Species: Hu
Applications: Flow, ICC/IF, IHC-P, PAGE
NB110-59086
Species: Hu, Pm, Bv(-), Mu(-), Rt(-)
Applications: WB, IHC, IHC-P
NBP2-37463
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready
MAB140
Species: Hu
Applications: Flow, IHC, CyTOF-ready, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NBP1-47974
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-16468
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP2-46117
Species: Hu
Applications: WB, IHC, IF
H00004112-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for MAGEB1 Partial Recombinant Protein (H00004112-Q01) (0)

There are no publications for MAGEB1 Partial Recombinant Protein (H00004112-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MAGEB1 Partial Recombinant Protein (H00004112-Q01) (0)

There are no reviews for MAGEB1 Partial Recombinant Protein (H00004112-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MAGEB1 Partial Recombinant Protein (H00004112-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MAGEB1 Products

Bioinformatics Tool for MAGEB1 Partial Recombinant Protein (H00004112-Q01)

Discover related pathways, diseases and genes to MAGEB1 Partial Recombinant Protein (H00004112-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MAGEB1 Partial Recombinant Protein (H00004112-Q01)

Discover more about diseases related to MAGEB1 Partial Recombinant Protein (H00004112-Q01).
 

Pathways for MAGEB1 Partial Recombinant Protein (H00004112-Q01)

View related products by pathway.

PTMs for MAGEB1 Partial Recombinant Protein (H00004112-Q01)

Learn more about PTMs related to MAGEB1 Partial Recombinant Protein (H00004112-Q01).

Blogs on MAGEB1

There are no specific blogs for MAGEB1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

MAGEB1 Antibody
NBP1-85406
GM-CSF [Unconjugated]
215-GM-010/CF

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human MAGEB1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol MAGEB1