Macro H2A.2 Antibody - BSA Free

Immunohistochemistry-Paraffin: Macro H2A.2 Antibody [NBP1-92094] - Analysis in human endometrium and liver tissues. Corresponding H2AFY2 RNA-seq data are presented for the same tissues.

Immunocytochemistry/Immunofluorescence: Macro H2A.2 Antibody [NBP1-92094] - Staining of human cell line U-2 OS shows localization to nucleoplasm. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: Macro H2A.2 Antibody [NBP1-92094] - Staining of human liver shows no positivity in hepatocytes as expected.

Immunohistochemistry-Paraffin: Macro H2A.2 Antibody [NBP1-92094] - Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts

Immunohistochemistry-Paraffin: Macro H2A.2 Antibody [NBP1-92094] - Staining of human endometrium shows moderate to strong nuclear positivity in stromal cells.

Immunohistochemistry-Paraffin: Macro H2A.2 Antibody [NBP1-92094] - Staining of human cerebellum shows moderate nuclear positivity in granular layer.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Macro H2A.2 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: ILSSKSLVLGQKLSLTQSDISHIGSMRVEGIVHPTTAEIDLKEDIGKALEKAGGKEFLETVKELRKSQGPL
• Predicted Species: Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MACROH2A2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval method is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Macro H2A.2 Protein (NBP1-92094PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Macro H2A.2 Antibody - BSA Free

• core histone macro-H2A.2
• core histone macroH2A2.2
• H2A histone family, member Y2
• Histone macroH2A2
• macroH2A2
• mH2A2

Background

Variant histone H2A which replaces conventional H2A in a subset of nucleosomes where it represses transcription. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling. May be involved in stable X chromosome inactivation

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Macro H2A.2 Antibody (NBP1-92094)(1)

Publication using NBP1-92094

• Nikolic A, Maule F, Bobyn A et al. macroH2A2 antagonizes epigenetic programs of stemness in glioblastoma Nature communications 2023-05-27 [PMID: 37244935] (IHC-P, Human)

Bioinformatics

• Gene Symbol: MACROH2A2
• Entrez:
  • 55506(Human)
• Uniprot:
  • Q9P0M6(Human)