Orthogonal Strategies: Immunohistochemistry-Paraffin: Macro H2A.2 Antibody [NBP1-92094] - Analysis in human endometrium and liver tissues. Corresponding H2AFY2 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Macro H2A.2 Antibody [NBP1-92094] - Staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: Macro H2A.2 Antibody [NBP1-92094] - Staining of human endometrium shows moderate to strong nuclear positivity in stromal cells.
Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.
Staining of human endometrium shows moderate to strong nuclear positivity in stromal cells.
Staining of human cell line U-2 OS shows localization to nucleoplasm.
Staining of human cerebellum shows moderate to strong nuclear positivity in both molecular and granular layer.
Orthogonal Strategies: Analysis in human endometrium and liver tissues using NBP1-92094 antibody. Corresponding H2AFY2 RNA-seq data are presented for the same tissues.
This antibody was developed against Recombinant Protein corresponding to amino acids: ILSSKSLVLGQKLSLTQSDISHIGSMRVEGIVHPTTAEIDLKEDIGKALEKAGGKEFLETVKELRKSQGPL
Predicted Species
Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MACROH2A2
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified
Alternate Names for Macro H2A.2 Antibody - BSA Free
core histone macro-H2A.2
core histone macroH2A2.2
H2A histone family, member Y2
Histone macroH2A2
macroH2A2
mH2A2
Background
Variant histone H2A which replaces conventional H2A in a subset of nucleosomes where it represses transcription. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling. May be involved in stable X chromosome inactivation
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our Macro H2A.2 Antibody - BSA Free and receive a gift card or discount.