Macro H2A.2 Antibody - Azide and BSA Free

Western Blot: Macro H2A.2 Antibody [H00055506-D01P] - Analysis of H2AFY2 expression in transfected 293T cell line by H2AFY2 polyclonal antibody.Lane 1: H2AFY2 transfected lysate(40.10 KDa).Lane 2: Non-transfected lysate.

Immunocytochemistry/Immunofluorescence: Macro H2A.2 Antibody [H00055506-D01P] - Analysis of antibody to H2AFY2 on HeLa cell. Antibody concentration 30 ug/ml.

• Reactivity: Hu
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

Macro H2A.2 Antibody - Azide and BSA Free Summary

• Immunogen: H2AFY2 (NP_061119.1, 1 a.a. - 372 a.a.) full-length human protein. MSGRSGKKKMSKLSRSARAGVIFPVGRLMRYLKKGTFKYRISVGAPVYMAAVIEYLAAEILELAGNAARDNKKARIAPRHILLAVANDEELNQLLKGVTIASGGVLPRIHPELLAKKRGTKGKSETILSPPPEKRGRKATSGKKGGKKSKAAKPRTSKKSKPKDSDKEGTSNSTSEDGPGDGFTILSSKSLVLGQKLSLTQSDISHIGSMRVEGIVHPTTAEIDLKEDIGKALEKAGGKEFLETVKELRKSQGPLEVAEAAVSQSSGLAAKFVIHCHIPQWGSDKCEEQLEETIKNCLSAAEDKKLKSVAFPPFPSGRNCFPKQTAAQVTLKAISAHFDDSSASSLKNVYFLLFDSESIGIYVQEMAKLDAK
• Specificity: Reacts with H2A histone family, member Y2.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MACROH2A2
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence
  • Western Blot
• Application Notes: This antibody is reactive against transfected lysate in western blot, and as a detection antibody in ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Macro H2A.2 Antibody - Azide and BSA Free

• core histone macro-H2A.2
• core histone macroH2A2.2
• H2A histone family, member Y2
• Histone macroH2A2
• macroH2A2
• mH2A2

Background

Variant histone H2A which replaces conventional H2A in a subset of nucleosomes where it represses transcription. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling. May be involved in stable X chromosome inactivation

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MACROH2A2
• Entrez:
  • 55506(Human)
• Uniprot:
  • NP_061119.1(Human)