LYNX1 Antibody

Images

 
Western Blot: LYNX1 Antibody [NBP1-80739] - Analysis in control (vector only transfected HEK293T lysate) and LYNX1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: LYNX1 Antibody [NBP1-80739] - Staining of human esophagus shows moderate cytoplasmic positivity in squamous epithelial cells.

Product Details

Summary
Product Discontinued
View other related LYNX1 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-80739
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

LYNX1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:IWCHQCTGFGGCSHGSRCLRDSTHCVTTATRVLSNTEDLPLVTKMCHIGCPDIPSLGLGPYVSIACCQTSLCNHD
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LYNX1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:10-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for LYNX1 Antibody

  • Ly-6 neurotoxin-like protein 1
  • Ly6/neurotoxin 1
  • ly-6/neurotoxin-like protein 1
  • MGC40364
  • secreted Ly6/uPAR related protein 2
  • secreted Ly-6/uPAR-related protein 2
  • SLURP2
  • SLURP-2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-13351
Species: Hu, ChHa
Applications: WB, IHC, IHC-P
AF1310
Species: Hu
Applications: WB, IHC, IP
NBP1-30052
Species: Hu, Mu, Rt, Av, Ch, GP, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-WhMt
MAB7636
Species: Hu
Applications: IHC
NBP2-02541
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24557
Species: Hu, Eq, Pm
Applications: WB, IHC-P
NBP1-87527
Species: Hu
Applications: IHC, IHC-P
NBP1-33610
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-05163
Species: Hu, Rt, Po, Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-28566
Species: Hu, Mu, Rt, Bv, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP
NBP2-13306
Species: Hu
Applications: WB, IHC, IHC-P
NB100-91348
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB300-137
Species: Hu, Mu, Rt, Ma
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-80739
Species: Hu
Applications: WB, IHC, IHC-P

Publications for LYNX1 Antibody (NBP1-80739) (0)

There are no publications for LYNX1 Antibody (NBP1-80739).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LYNX1 Antibody (NBP1-80739) (0)

There are no reviews for LYNX1 Antibody (NBP1-80739). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for LYNX1 Antibody (NBP1-80739) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional LYNX1 Products

LYNX1 NBP1-80739

Bioinformatics Tool for LYNX1 Antibody (NBP1-80739)

Discover related pathways, diseases and genes to LYNX1 Antibody (NBP1-80739). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LYNX1 Antibody (NBP1-80739)

Discover more about diseases related to LYNX1 Antibody (NBP1-80739).
 

Pathways for LYNX1 Antibody (NBP1-80739)

View related products by pathway.

PTMs for LYNX1 Antibody (NBP1-80739)

Learn more about PTMs related to LYNX1 Antibody (NBP1-80739).

Blogs on LYNX1

There are no specific blogs for LYNX1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LYNX1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LYNX1