LYNX1 Antibody

Product Discontinued

LYNX1 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:IWCHQCTGFGGCSHGSRCLRDSTHCVTTATRVLSNTEDLPLVTKMCHIGCPDIPSLGLGPYVSIACCQTSLCNHD
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: LYNX1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 -1:1000
  • Immunohistochemistry-Paraffin 1:500 -1:1000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for LYNX1 Antibody

• Ly-6 neurotoxin-like protein 1
• Ly6/neurotoxin 1
• ly-6/neurotoxin-like protein 1
• MGC40364
• secreted Ly6/uPAR related protein 2
• secreted Ly-6/uPAR-related protein 2
• SLURP2
• SLURP-2

Background

LYNX1 encodes a member of the Ly-6/neurotoxin gene family, a group of lymphocyte antigens that attach to the cell surface by a glycosylphosphatidylinositol anchor and have a unique structure showing conserved 8-10 cysteine residues with a characteristic spacing pattern. Functional analysis indicates that this protein is not a ligand or neurotransmitter but has the capacity to enhance nicotinic acetylcholine receptor function in the presence of acetylcholine. This gene may also play a role in the pathogenesis of psoriasis vulgaris. Alternatively spliced variants encoding different isoforms have been identified. [provided by RefSeq]. Transcript Variant: This variant (SLURP2) differs in the 5' UTR and in the coding region, compared to variant 1. The resulting isoform (b) is shorter, and has a distinct N-terminus when compared to isoform a.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: LYNX1