We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Ly-6G5B Recombinant Protein Antigen

Images

 
There are currently no images for Ly-6G5B Protein (NBP2-14208PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Ly-6G5B Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human LY6G5B.

Source: E. coli

Amino Acid Sequence: CCQYDYCNSWSSPQLQSSLPEPHDRPLALPLSDSQIQWFYQALNLSLPLPNFHAGTEPDGLDPMVTLSLNLGLSFAELRRMYLFLNSSGLLVLPQ

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
LY6G5B
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-14208.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Ly-6G5B Recombinant Protein Antigen

  • C6orf19
  • chromosome 6 open reading frame 19
  • G5B
  • lymphocyte antigen 6 complex locus protein G5b
  • lymphocyte antigen 6 complex, locus G5B
  • lymphocyte antigen-6 G5B

Background

LY6G5B belongs to a cluster of leukocyte antigen-6 (LY6) genes located in the major histocompatibility complex (MHC) class III region on chromosome 6. Members of the LY6 superfamily typically contain 70 to 80 amino acids, including 8 to 10 cysteines. Most LY6 proteins are attached to the cell surface by a glycosylphosphatidylinositol (GPI) anchor that is directly involved in signal transduction (Mallya et al., 2002 [PubMed 12079290]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

1849-NK
Species: Hu
Applications: BA
MAB9350
Species: Hu
Applications: IHC,  IHC-P, WB
8457-AS
Species: Hu
Applications: EnzAct
NBP3-25594
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
AF1226
Species: Mu
Applications: CyTOF-ready, Flow, ICC, WB
NBP3-52299
Species: Hu
Applications: ELISA,  IHC-P, WB
NBP1-87894
Species: Hu
Applications: IHC,  IHC-P
NBP2-22124
Species: Hu, Mu, Pm
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
AF5245
Species: Hu, Mu, Rt
Applications: IHC, WB
NB120-2860
Species: Ba, Bv, Ch, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
MAB7089
Species: Mu
Applications: CyTOF-ready, Flow, IHC
AF1990
Species: Mu
Applications: CyTOF-ready, Flow, WB
NBP2-15669
Species: Mu, Rt, Ze
Applications: IHC-WhMt, IHC, WB
H00001130-Q01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP3-15243
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NB120-6405
Species: Rt
Applications: B/N, CyTOF-ready, EM, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP

Publications for Ly-6G5B Protein (NBP2-14208PEP) (0)

There are no publications for Ly-6G5B Protein (NBP2-14208PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Ly-6G5B Protein (NBP2-14208PEP) (0)

There are no reviews for Ly-6G5B Protein (NBP2-14208PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Ly-6G5B Protein (NBP2-14208PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Ly-6G5B Products

Array NBP2-14208PEP

Research Areas for Ly-6G5B Protein (NBP2-14208PEP)

Find related products by research area.

Blogs on Ly-6G5B

There are no specific blogs for Ly-6G5B, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Ly-6G5B Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol LY6G5B