LUZP2 Antibody

Images

 
Immunohistochemistry-Paraffin: LUZP2 Antibody [NBP2-14564] - Staining of human cerebellum shows distinct positivity in astrocytes.
Immunohistochemistry-Paraffin: LUZP2 Antibody [NBP2-14564] Staining of human cerebral cortex shows moderate nuclear positivity in neuronal cells.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

LUZP2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: DYEELEKQLKEVFKERSTILRQLTKTSRELDGIKVNLQSLKNDEQSAKTD VQKLLELGQKQREEMKSLQEALQNQLKETSEKAEKHQATINFLKTEVERK SKMIRDL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LUZP2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
LUZP2 Protein (NBP2-14564PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for LUZP2 Antibody

  • KFSP2566
  • LUZP2 leucine zipper protein 2
  • PRO6246

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-750
Species: Hu, Mu, Rt, Mk, Pm, Sh
Applications: WB, ICC/IF, IP
NBP2-37922
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00002620-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
NB110-60011
Species: Hu, Mu
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P, IP
NBP1-79948
Species: Hu, Rt
Applications: WB
NBP1-80090
Species: Hu
Applications: WB

Publications for LUZP2 Antibody (NBP2-14564) (0)

There are no publications for LUZP2 Antibody (NBP2-14564).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LUZP2 Antibody (NBP2-14564) (0)

There are no reviews for LUZP2 Antibody (NBP2-14564). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for LUZP2 Antibody (NBP2-14564) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional LUZP2 Products

LUZP2 NBP2-14564

Bioinformatics Tool for LUZP2 Antibody (NBP2-14564)

Discover related pathways, diseases and genes to LUZP2 Antibody (NBP2-14564). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LUZP2 Antibody (NBP2-14564)

Discover more about diseases related to LUZP2 Antibody (NBP2-14564).

Blogs on LUZP2

There are no specific blogs for LUZP2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LUZP2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LUZP2