LRRC49 Antibody

Images

 
Immunohistochemistry: LRRC49 Antibody [NBP2-14202] - Staining of human cerebral cortex shows strong nuclear positivity in neuronal cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

LRRC49 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: SHVDNLNGLDSLTELNLRHNQITFVRDVDNLPCLQHLFLSFNNISSFDSV SCLADSSSLSDITFDGNPIAQESWYKHTVLQNMMQLRQLDMKRITEEERR MASVLAKKEEEKKRESHKQSLLKEKKRLTINNVARQWDLQQQRVA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (92%), Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LRRC49
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
LRRC49 Protein (NBP2-14202PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for LRRC49 Antibody

  • FLJ20156
  • leucine rich repeat containing 49
  • leucine-rich repeat-containing protein 49
  • PGs4
  • Tubulin polyglutamylase complex subunit 4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-86226
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92025
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15142
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-02450
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-14202
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for LRRC49 Antibody (NBP2-14202) (0)

There are no publications for LRRC49 Antibody (NBP2-14202).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LRRC49 Antibody (NBP2-14202) (0)

There are no reviews for LRRC49 Antibody (NBP2-14202). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for LRRC49 Antibody (NBP2-14202) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional LRRC49 Products

Bioinformatics Tool for LRRC49 Antibody (NBP2-14202)

Discover related pathways, diseases and genes to LRRC49 Antibody (NBP2-14202). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LRRC49 Antibody (NBP2-14202)

Discover more about diseases related to LRRC49 Antibody (NBP2-14202).
 

Pathways for LRRC49 Antibody (NBP2-14202)

View related products by pathway.

PTMs for LRRC49 Antibody (NBP2-14202)

Learn more about PTMs related to LRRC49 Antibody (NBP2-14202).

Blogs on LRRC49

There are no specific blogs for LRRC49, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LRRC49 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LRRC49