LRRC37A2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: LRRC37A2 Antibody [NBP2-33438] - Staining of human cell line RH-30 shows localization to vesicles.
Immunohistochemistry-Paraffin: LRRC37A2 Antibody [NBP2-33438] - Staining of human testis shows strong cytoplasmic positivity in subset of cells in cells in seminiferus ducts.
Immunohistochemistry: LRRC37A2 Antibody [NBP2-33438] - Staining of human nasopharynx shows strong membranous positivity in respiratory epithelial cells.
Immunohistochemistry: LRRC37A2 Antibody [NBP2-33438] - Staining of liver.
Immunohistochemistry: LRRC37A2 Antibody [NBP2-33438] - Staining of testis cancer.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

LRRC37A2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: AKSLINSPSQGAFSSLGDLSPQENPFLEVSAPSEH
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LRRC37A2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
LRRC37A2 Protein (NBP2-33438PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for LRRC37A2 Antibody

  • C114 SLIT-Like Testicular Protein
  • Leucine Rich Repeat Containing 37, Member A2
  • Leucine-Rich Repeat-Containing Protein 37A2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB6918
Species: Hu
Applications: WB
NBP2-15365
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
MAB6598
Species: Hu, Mu, Rt
Applications: WB
NBP2-03062
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: Flow, IHC, IHC-P, WB
NBP1-81838
Species: Hu, Mu
Applications: IHC, IHC-P, WB
H00079877-M02
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP2-67702
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-46666
Species: Hu
Applications: IHC, IHC-P

Publications for LRRC37A2 Antibody (NBP2-33438) (0)

There are no publications for LRRC37A2 Antibody (NBP2-33438).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LRRC37A2 Antibody (NBP2-33438) (0)

There are no reviews for LRRC37A2 Antibody (NBP2-33438). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for LRRC37A2 Antibody (NBP2-33438) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional LRRC37A2 Products

Bioinformatics Tool for LRRC37A2 Antibody (NBP2-33438)

Discover related pathways, diseases and genes to LRRC37A2 Antibody (NBP2-33438). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LRRC37A2 Antibody (NBP2-33438)

Discover more about diseases related to LRRC37A2 Antibody (NBP2-33438).

Blogs on LRRC37A2

There are no specific blogs for LRRC37A2, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LRRC37A2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LRRC37A2
Uniprot