LRRC18 Antibody


Western Blot: LRRC18 Antibody [NBP1-81102] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed more
Immunohistochemistry-Paraffin: LRRC18 Antibody [NBP1-81102] - Staining in human fallopian tube and prostate tissues using anti-LRRC18 antibody. Corresponding LRRC18 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: LRRC18 Antibody [NBP1-81102] - Staining of human fallopian tube shows high expression.
Immunohistochemistry-Paraffin: LRRC18 Antibody [NBP1-81102] - Staining of human prostate shows low expression as expected.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

LRRC18 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: IFIDSIRRLENLYVVEEKDLCAACLRKCQNARDNLNRIKNMATTTPRKTIFPNLISPNSMAKDSWEDWRIRL
Specificity of human LRRC18 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
LRRC18 Protein (NBP1-81102PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for LRRC18 Antibody

  • leucine rich repeat containing 18
  • leucine-rich repeat-containing protein 18
  • MGC34773
  • UNQ933
  • UNQ9338
  • VKGE9338


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Mu
Applications: WB, IHC
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
Species: Hu, Mu
Applications: WB, Flow, CyTOF-ready, ICC
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, ICC
Species: Hu
Applications: IHC, IHC-P

Publications for LRRC18 Antibody (NBP1-81102) (0)

There are no publications for LRRC18 Antibody (NBP1-81102).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LRRC18 Antibody (NBP1-81102) (0)

There are no reviews for LRRC18 Antibody (NBP1-81102). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for LRRC18 Antibody (NBP1-81102) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for LRRC18 Antibody (NBP1-81102)

Discover related pathways, diseases and genes to LRRC18 Antibody (NBP1-81102). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LRRC18 Antibody (NBP1-81102)

Discover more about diseases related to LRRC18 Antibody (NBP1-81102).

Blogs on LRRC18

There are no specific blogs for LRRC18, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our LRRC18 Antibody and receive a gift card or discount.


Gene Symbol LRRC18