LPAR6/P2RY5 Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit LPAR6/P2RY5 Antibody - BSA Free (NBP3-09506) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C-terminal region of Human LPAR6/P2RY5 (NP_005758). Peptide sequence VAAVRTMYPITLCIAVSNCCFDPIVYYFTSDTIQNSIKMKNWSVRRSDFR |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
LPAR6 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
|
| Theoretical MW |
38 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for LPAR6/P2RY5 Antibody - BSA Free
Background
The purinergic receptor P2Y5 (LPAR6/P2RY5) is a member of the Purinergic Receptor subfamily. Membrane-bound P2 receptors mediate the actions of extracellular nucleotides in cell-to-cell signaling. P2Y5 expression has been documented in dendritic cells, monocyte-derived dendritic cells, and macrophages. ESTs have been isolated from embryo, heart/melanocyte/uterus, kidney, liver/spleen, lung, pancreas, placenta, uterus, and vessel libraries.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IP, WB
Species: Bt, Ha, Hu, Pm, Mu, Pm, Rt
Applications: Flow, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: WB
Species: Hu
Applications: Flow-CS, Flow, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: ICC, Simple Western, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Species: Bt, Bv, Ca, Eq, Hu, Mu
Applications: IHC, IHC-P
Species: Ch, Hu
Applications: IHC, IHC-P, IP, KD, WB
Species: Hu, Pm, Pm
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, WB
Species: Hu, Mu, Sh
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
Species: Hu
Applications: WB
Species: Hu
Applications: EnzAct
Species: Hu
Applications: WB
Publications for LPAR6/P2RY5 Antibody (NBP3-09506) (0)
There are no publications for LPAR6/P2RY5 Antibody (NBP3-09506).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for LPAR6/P2RY5 Antibody (NBP3-09506) (0)
There are no reviews for LPAR6/P2RY5 Antibody (NBP3-09506).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for LPAR6/P2RY5 Antibody (NBP3-09506) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional LPAR6/P2RY5 Products
Research Areas for LPAR6/P2RY5 Antibody (NBP3-09506)
Find related products by research area.
|
Blogs on LPAR6/P2RY5