LINC02694 Antibody

Images

 
Western Blot: LINC02694 Antibody [NBP2-82850] - Host: Rabbit. Target Name: C15orf53. Sample Type: 293T Whole Cell lysates. Antibody Dilution: 1.0ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

LINC02694 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human C15orf53. Peptide sequence: WVQGNAWISCITKFDSKRSPEVASSPSYLTVPRRSPLPVFLRPSDRCVCG The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
C15orf53
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for LINC02694 Antibody

  • chromosome 15 open reading frame 53

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-81841
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF2000
Species: Hu
Applications: WB, Simple Western, Flow, CyTOF-ready
NBP3-05549
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, ICC/IF, IHC
NBP1-86489
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-67599
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-00880
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-94035
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NBP2-15626
Species: Hu
Applications: WB
NBP1-52813
Species: Hu
Applications: WB, ICC/IF

Publications for LINC02694 Antibody (NBP2-82850) (0)

There are no publications for LINC02694 Antibody (NBP2-82850).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LINC02694 Antibody (NBP2-82850) (0)

There are no reviews for LINC02694 Antibody (NBP2-82850). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for LINC02694 Antibody (NBP2-82850) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional LINC02694 Products

Bioinformatics Tool for LINC02694 Antibody (NBP2-82850)

Discover related pathways, diseases and genes to LINC02694 Antibody (NBP2-82850). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LINC02694 Antibody (NBP2-82850)

Discover more about diseases related to LINC02694 Antibody (NBP2-82850).

Blogs on LINC02694

There are no specific blogs for LINC02694, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LINC02694 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol C15orf53