![Western Blot: LIN10 Antibody [H00080262-B01P] - Analysis of C16orf70 expression in transfected 293T cell line by C16orf70 polyclonal antibody. Lane 1: LIN10 transfected lysate(46.42 KDa). Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/LIN10-Antibody-Western-Blot-H00080262-B01P-img0002.jpg "Western Blot: LIN10 Antibody [H00080262-B01P] - Analysis of C16orf70 expression in transfected 293T cell line by C16orf70 polyclonal antibody. Lane 1: LIN10 transfected lysate(46.42 KDa). Lane 2: Non-transfected lysate.")
| Reactivity | HuSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Description | Novus Biologicals Mouse LIN10 Antibody - Azide and BSA Free (H00080262-B01P) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | LIN10 (NP_079463, 1 a.a. - 422 a.a.) full-length human protein. MLDLEVVPERSLGNEQWEFTLGMPLAQAVAILQKHCRIIKNVQVLYSEQSPLSHDLILNLTQDGIKLMFDAFNQRLKVIEVCDLTKVKLKYCGVHFNSQAIAPTIEQIDQSFGATHPGVYNSAEQLFHLNFRGLSFSFQLDSWTEAPKYEPNFAHGLASLQIPHGATVKRMYIYSGNSLQDTKAPMMPLSCFLGNVYAESVDVLRDGTGPAGLRLRLLAAGCGPGLLADAKMRVFERSVYFGDSCQDVLSMLGSPHKVFYKSEDKMKIHSPSPHKQVPSKCNDYFFNYFTLGVDILFDANTHKVKKFVLHTNYPGHYNFNIYHRCEFKIPLAIKKENADGQTETCTTYSKWDNIQELLGHPVEKPVVLHRSSSPNNTNPFGSTFCFGLQRMIFEVMQNNHIASVTLYGPPRPGSHLRTAELP |
| Specificity | LIN10 - lin-10 homolog (C. elegans), |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Mouse |
| Gene | C16ORF70 |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.4) |
| Preservative | No Preservative |
| Purity | Protein A purified |
![Immunohistochemistry EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Immunohistochemistry_20892.jpg)
![Immunocytochemistry EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Immunocytochemistry__Immunofluorescence_21143.jpg)
![Western Blot EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Western_Blot_19925.jpg)
![Western Blot Syntaxin-BP1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Syntaxin-BP1_AF5675_Western_Blot_5803.jpg)
![Immunohistochemistry Syntaxin-BP1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Syntaxin-BP1_AF5675_Immunohistochemistry_7192.jpg)
![Knockout Validated Syntaxin-BP1 Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af5675_human-mouse-rat-syntaxin-bp1-affinity-purified-polyclonal-ab-knockout-validated-2410202414339.png)
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]](https://images.novusbio.com/images/Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP1-97019-img0004.jpg "Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]")