LARP4 Antibody

Images

 
Genetic Strategies: Western Blot: LARP4 Antibody [NBP1-80890] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2. Remaining relative intensity is presented.
Immunocytochemistry/ Immunofluorescence: LARP4 Antibody [NBP1-80890] - Immunofluorescent staining of human cell line A-431 shows localization to cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: LARP4 Antibody [NBP1-80890] - Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
     

Genetic Strategies

   

Order Details

LARP4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: KTNAAAMNMGRPFQKNRVKPQFRSSGGSEHSTEGSVSLGDGQLNRYSSRNFPAERHNPTVTGHQEQTYLQKETSTLQVEQNGDYGRGR
Specificity
Specificity of human LARP4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LARP4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
LARP4 Protein (NBP1-80890PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (82%).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for LARP4 Antibody

  • c-Mpl binding protein
  • DKFZp686E039
  • La ribonucleoprotein domain family member 4
  • La ribonucleoprotein domain family, member 4
  • la-related protein 4
  • MGC74631
  • PP13296

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-00612
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-33549
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB120-6125
Species: Hu, Bv, Ca, Pm, Xp, Dr(-), Mu(-)
Applications: WB, ELISA, Flow, ICC/IF, IP, MiAr, CyTOF-ready
H00055323-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-67015
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-80890
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for LARP4 Antibody (NBP1-80890) (0)

There are no publications for LARP4 Antibody (NBP1-80890).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LARP4 Antibody (NBP1-80890) (0)

There are no reviews for LARP4 Antibody (NBP1-80890). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for LARP4 Antibody (NBP1-80890) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for LARP4 Antibody (NBP1-80890)

Discover related pathways, diseases and genes to LARP4 Antibody (NBP1-80890). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LARP4 Antibody (NBP1-80890)

Discover more about diseases related to LARP4 Antibody (NBP1-80890).
 

Pathways for LARP4 Antibody (NBP1-80890)

View related products by pathway.

Blogs on LARP4

There are no specific blogs for LARP4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LARP4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LARP4