LAGE3 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: LAGE3 Antibody [NBP2-32715] - Staining of human cell line MCF7 shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: LAGE3 Antibody [NBP2-32715] - Staining of human kidney shows strong nuclear positivity in cells in tubules.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

LAGE3 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: IFTLSVPFPTPLEAEIAHGSLAPDAEPHQRVVGKDLTVSGRILVVRWKAEDCRLLRISVINFLDQLSLVVRTMQRFG
Specificity
Specificity of human LAGE3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LAGE3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. Use in Western blot reported in reported in scientific literature (PMID: 31481669).
Control Peptide
LAGE3 Protein (NBP2-32715PEP)
Publications
Read Publication using
NBP2-32715 in the following applications:

  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for LAGE3 Antibody

  • L antigen family, member 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-47714
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-49659
Species: Hu
Applications: IHC, IHC-P
NBP2-61149
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-48002
Species: Hu, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-76825
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
NBP2-00823
Species: Hu, Mu, Rt, Ca
Applications: WB, Flow, IHC, IHC-P
NBP2-31361
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-81988
Species: Hu
Applications: IHC, IHC-P

Publications for LAGE3 Antibody (NBP2-32715)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for LAGE3 Antibody (NBP2-32715) (0)

There are no reviews for LAGE3 Antibody (NBP2-32715). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for LAGE3 Antibody (NBP2-32715) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional LAGE3 Products

Array NBP2-32715

Bioinformatics Tool for LAGE3 Antibody (NBP2-32715)

Discover related pathways, diseases and genes to LAGE3 Antibody (NBP2-32715). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LAGE3 Antibody (NBP2-32715)

Discover more about diseases related to LAGE3 Antibody (NBP2-32715).
 

Pathways for LAGE3 Antibody (NBP2-32715)

View related products by pathway.

Blogs on LAGE3

There are no specific blogs for LAGE3, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LAGE3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LAGE3