LAGE3 Antibody - BSA Free

Western Blot: LAGE3 Antibody [NBP2-32715] - Role of GON7 on KEOPS complex stability. Western blot analysis of protein expression level of the five KEOPS subunits in lymphoblastoid cell lines from two unaffected relatives (A.II-1 and A.II-5), four individuals with the GON7 mutation p.Tyr*7, one individual with the OSGEP (NBP2-00823) mutations p.Arg325Gln and p.Arg280His, and one individual with GAMOS linked to WDR73 mutations. One representative western blot is shown (three independent experiments were performed). Alpha-Tubulin was used as a loading control. Image collected and cropped by CiteAb from the following publication (//www.ncbi.nlm.nih.gov/pmc/articles/PMC6722078/) licensed under a CC-BY license.

Immunocytochemistry/Immunofluorescence: LAGE3 Antibody [NBP2-32715] - Staining of human cell line MCF7 shows localization to nucleoplasm. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: LAGE3 Antibody [NBP2-32715] - Staining of human kidney shows strong nuclear positivity in cells in tubules.

Immunohistochemistry-Paraffin: LAGE3 Antibody [NBP2-32715] -Staining of human pancreas shows strong nuclear positivity in exocrine glandular cells.

Immunohistochemistry-Paraffin: LAGE3 Antibody [NBP2-32715] -Staining of human fallopian tube shows moderate to strong nuclear positivity in glandular cells.

Immunohistochemistry-Paraffin: LAGE3 Antibody [NBP2-32715] -Staining of human testis shows strong nuclear positivity in Leydig cells.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

LAGE3 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit LAGE3 Antibody - BSA Free (NBP2-32715) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-LAGE3 Antibody: Cited in 3 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: IFTLSVPFPTPLEAEIAHGSLAPDAEPHQRVVGKDLTVSGRILVVRWKAEDCRLLRISVINFLDQLSLVVRTMQRFG
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: LAGE3
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot Reported in reported in scientific literature (PMID: 31481669).
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  LAGE3 Protein (NBP2-32715PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for LAGE3 Antibody - BSA Free

• L antigen family, member 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for LAGE3 Antibody (NBP2-32715)(3)

Publications using NBP2-32715

• Xing Y, Liu Y, Qi Z Et al. LAGE3 promoted cell proliferation, migration, and invasion and inhibited cell apoptosis of hepatocellular carcinoma by facilitating the JNK and ERK signaling pathway Cellular & molecular biology letters 2021-11-27 [PMID: 34837962] (IHC-P, Human)
• Dong X, Yang Q, Gu J et al. Identification and validation of L Antigen Family Member 3 as an immune-related biomarker associated with the progression of papillary thyroid cancer International immunopharmacology 2020-12-10 [PMID: 33310661] (WB, Human)
• Arrondel C, Missoury S, Snoek R et al. Defects in t6A tRNA modification due to GON7 and YRDC mutations lead to Galloway-Mowat syndrome Nat Commun 2019-09-03 [PMID: 31481669] (WB, Human)

Bioinformatics

• Gene Symbol: LAGE3