Kv9.3 Recombinant Protein Antigen

Images

 
There are currently no images for Kv9.3 Protein (NBP1-81334PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Kv9.3 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human KCNS3.

Source: E. coli

Amino Acid Sequence: KDIDVDQCSEDAPEKCHELPYFNIRDIYAQRMHAFITSLSSVGIVVSDPDSTDASSIEDNEDICNTTSLENCTA

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
KCNS3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-81334.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Kv9.3 Recombinant Protein Antigen

  • delayed-rectifier K(+) channel alpha subunit 3
  • KV9.3
  • MGC9481
  • potassium voltage-gated channel subfamily S member 3
  • potassium voltage-gated channel, delayed-rectifier, subfamily S, member 3
  • Shab-related delayed-rectifier K+ channel alpha subunit 3
  • voltage-gated potassium channel protein Kv9.3
  • voltage-gated potassium channel subunit Kv9.3

Background

Voltage-gated potassium channels form the largest and most diversified class of ion channels and are present in both excitable and nonexcitable cells. Their main functions are associated with the regulation of the resting membrane potential and the control of the shape and frequency of action potentials. The alpha subunits are of 2 types: those that are functional by themselves and those that are electrically silent but capable of modulating the activity of specific functional alpha subunits. The protein encoded by this gene is not functional by itself but can form heteromultimers with member 1 and with member 2 (and possibly other members) of the Shab-related subfamily of potassium voltage-gated channel proteins. This gene belongs to the S subfamily of the potassium channel family. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-38498
Species: Hu
Applications: IHC,  IHC-P
NBP2-76939
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP3-46349
Species: Hu, Mu, Rt
Applications: ELISA, WB
NBP3-03750
Species: Hu, Mu, Rt
Applications: ELISA, IHC,  IHC-P, WB
NBP3-03729
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
NB300-279
Species: Ha, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, WB
NBP3-03748
Species: Mu
Applications: IHC,  IHC-P, WB
NBP3-46347
Species: Hu, Mu, Rt
Applications: ELISA, WB
NBP2-46518
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-01763
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, WB
H00002038-M01
Species: Hu
Applications: ELISA, ICC/IF, WB
H00005555-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP3-46899
Species: Hu
Applications: ELISA, ICC/IF, WB
NBP2-85189
Species: Hu
Applications: IHC,  IHC-P, WB
H00003748-M01
Species: Hu, Mu, Rb
Applications: ELISA, ICC/IF, WB
NBP2-48533
Species: Hu
Applications: IHC,  IHC-P
NBP2-37447
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P
NBP2-01526
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB

Publications for Kv9.3 Protein (NBP1-81334PEP) (0)

There are no publications for Kv9.3 Protein (NBP1-81334PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Kv9.3 Protein (NBP1-81334PEP) (0)

There are no reviews for Kv9.3 Protein (NBP1-81334PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Kv9.3 Protein (NBP1-81334PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Kv9.3 Products

Array NBP1-81334PEP

Research Areas for Kv9.3 Protein (NBP1-81334PEP)

Find related products by research area.

Blogs on Kv9.3

There are no specific blogs for Kv9.3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Kv9.3 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol KCNS3