Kv4.1 Recombinant Protein Antigen

Images

 
There are currently no images for Kv4.1 Recombinant Protein Antigen (NBP2-55128PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Kv4.1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human KCND1.

Source: E. coli

Amino Acid Sequence: NTLDRYPDTLLGSSEKEFFYDADSGEYFFDRDPDMFRHVLNFYRTGRLHCPRQECIQAFDEELAFYGLVPELVGDCCLEEYRDRKKENAERLAEDEEAEQ

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
KCND1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-55128.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Kv4.1 Recombinant Protein Antigen

  • Kv4.1
  • potassium voltage-gated channel subfamily D member 1
  • potassium voltage-gated channel, Shal-related subfamily, member 1
  • shal-type potassium channel
  • voltage-gated potassium channel Kv4.1
  • Voltage-gated potassium channel subunit Kv4.1

Background

Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. Four sequence-related potassium channel genes - shaker, shaw, shab, and shal - have been identified in Drosophila, and each has been shown to have human homolog(s). This gene encodes a member of the potassium channel, voltage-gated, shal-related subfamily, members of which form voltage-activated A-type potassium ion channels and are prominent in the repolarization phase of the action potential. This gene is expressed at moderate levels in all tissues analyzed, with lower levels in skeletal muscle. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-52497
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, WB
NBP3-03750
Species: Hu, Mu, Rt
Applications: ELISA, IHC,  IHC-P, WB
NBP3-46347
Species: Hu, Mu, Rt
Applications: ELISA, WB
NBP2-38498
Species: Hu
Applications: IHC,  IHC-P
NBP2-85189
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-76939
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-19020
Species: Bv, Hu, Mu, Po, Rt
Applications: WB
NBP2-48533
Species: Hu
Applications: IHC,  IHC-P
NBP3-46349
Species: Hu, Mu, Rt
Applications: ELISA, WB
NBP3-03729
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
H00030819-M01
Species: Hu
Applications: ELISA, IHC,  IHC-P, KD, WB
MAB2360
Species: Hu
Applications: CyTOF-ready, Flow, IP
H00003748-M01
Species: Hu, Mu, Rb
Applications: ELISA, ICC/IF, WB
H00003753-M01
Species: Ca, Gp, Hu, Pm, Rt
Applications: ELISA, ICC/IF, KD, WB
NBP3-24946
Species: Hu
Applications: ICC/IF
NBP2-01249
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, WB
NBP2-12897
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, MiAr, WB
NBP3-03109
Species: Hu, Mu
Applications: IHC,  IHC-P, WB

Publications for Kv4.1 Recombinant Protein Antigen (NBP2-55128PEP) (0)

There are no publications for Kv4.1 Recombinant Protein Antigen (NBP2-55128PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Kv4.1 Recombinant Protein Antigen (NBP2-55128PEP) (0)

There are no reviews for Kv4.1 Recombinant Protein Antigen (NBP2-55128PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Kv4.1 Recombinant Protein Antigen (NBP2-55128PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Kv4.1 Products

Research Areas for Kv4.1 Recombinant Protein Antigen (NBP2-55128PEP)

Find related products by research area.

Blogs on Kv4.1

There are no specific blogs for Kv4.1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Kv4.1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol KCND1