We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Kv1.4 Recombinant Protein Antigen

Images

 
There are currently no images for Kv1.4 Protein (NBP1-89691PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Kv1.4 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human KCNA4.

Source: E. coli

Amino Acid Sequence: NFNYFYHRETENEEQTQLTQNAVSCPYLPSNLLKKFRSSTSSSLGDKSEYLEMEEGVKESLCAKEEKCQGKGDDSETDKNNCSNAKAVETDV

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
KCNA4
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89691.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Kv1.4 Recombinant Protein Antigen

  • cardiac potassium channel
  • fetal skeletal muscle potassium channel
  • HBK4
  • HK1
  • HPCN2
  • HPCN2HUKII
  • KCNA4
  • KCNA4L
  • KCNA8
  • Kv1.4
  • PCN2
  • potassium channel 2
  • potassium voltage-gated channel subfamily A member 4
  • potassium voltage-gated channel, shaker-related subfamily, member 4
  • potassium voltage-gated channel, shaker-related subfamily, member 4-like
  • rapidly inactivating potassium channel
  • shaker-related potassium channel Kv1.4
  • type A potassium channel
  • Voltage-gated K(+) channel HuKII
  • Voltage-gated potassium channel HBK4
  • Voltage-gated potassium channel HK1
  • Voltage-gated potassium channel subunit Kv1.4

Background

In neurons voltage-dependent potassium channels are key determinants of the resting membrane potential and of membrane excitability, conditioning the frequency, and shape of action potential. Potassium channels are encoded by numerous genes whose products can be classified into distinct subfamilies. The most distinctively characterized is that of the Kv1 shaker class.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-76939
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP3-03748
Species: Mu
Applications: IHC,  IHC-P, WB
NBP3-03750
Species: Hu, Mu, Rt
Applications: ELISA, IHC,  IHC-P, WB
NBP3-46349
Species: Hu, Mu, Rt
Applications: ELISA, WB
NBP3-03729
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
NBP2-38498
Species: Hu
Applications: IHC,  IHC-P
NBP3-03109
Species: Hu, Mu
Applications: ELISA, IHC,  IHC-P, WB
NBP2-48533
Species: Hu
Applications: IHC,  IHC-P
NBP2-12897
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, MiAr, WB
NBP3-24946
Species: Hu
Applications: ICC/IF
H00003753-M01
Species: Ca, Gp, Hu, Pm, Rt
Applications: ELISA, ICC/IF, KD, WB
NBP2-85189
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-02272
Species: Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, WB
NBP1-06046
Species: Hu
Applications: IHC,  IHC-P, PEP-ELISA, WB
NB500-180
Species: Hu, Ma, Mu, Po, Rt
Applications: ICC/IF, IP, KO, Simple Western, WB
NBP2-14986
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
H00030819-M01
Species: Hu
Applications: ELISA, IHC,  IHC-P, KD, WB
NBP3-03744
Species: Hu, Mu, Rt
Applications: WB

Publications for Kv1.4 Protein (NBP1-89691PEP) (0)

There are no publications for Kv1.4 Protein (NBP1-89691PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Kv1.4 Protein (NBP1-89691PEP) (0)

There are no reviews for Kv1.4 Protein (NBP1-89691PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Kv1.4 Protein (NBP1-89691PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Kv1.4 Products

Array NBP1-89691PEP

Research Areas for Kv1.4 Protein (NBP1-89691PEP)

Find related products by research area.

Blogs on Kv1.4

There are no specific blogs for Kv1.4, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Kv1.4 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol KCNA4